BioLiP

>protein
PSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGEQSCDQKLTNT
NRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDD
DEPGPWTKEGKDRIKKLGLTMQYPEGYLEAL

The query sequence (length=191) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3clz:B	210	201	0.9948	0.9048	0.9453	1.71e-139	3clz:A, 3clz:C, 3clz:D, 8jig:A, 8jig:B, 6vcs:A, 6vcs:B, 6vcs:E
2	2zkd:A	210	196	0.8429	0.7667	0.8214	1.18e-117	3f8i:A, 3f8i:B, 3f8j:B, 3fde:A, 3fde:B, 6m2v:B, 6m2v:A, 2zkd:B, 2zke:A, 2zkf:A, 2zo0:B, 2zo1:B, 2zo2:B
3	4pw7:E	198	193	0.7435	0.7172	0.7358	3.74e-101	4pw5:A, 4pw5:B, 4pw5:E, 4pw5:F, 4pw6:A, 4pw6:B, 4pw7:A, 4pw7:B, 4pw7:F
4	4ygi:A	150	172	0.3141	0.4000	0.3488	5.65e-21	3q0b:X, 3q0c:X, 3q0c:A, 3q0d:X, 3q0d:A, 3q0f:A, 3q0f:X
5	6a5n:A	502	177	0.3246	0.1235	0.3503	1.02e-20
6	6ghs:A	285	137	0.2775	0.1860	0.3869	1.88e-19
7	6a5m:A	488	176	0.3351	0.1311	0.3636	4.70e-19	6a5k:A
8	4qen:A	472	183	0.3194	0.1292	0.3333	1.45e-16	4qeo:A, 4qep:A
9	4nj5:A	482	198	0.2775	0.1100	0.2677	1.85e-08
10	6qgr:A	437	46	0.0838	0.0366	0.3478	0.18	6qgt:A, 6qii:A
11	5mg5:L	396	36	0.0733	0.0354	0.3889	0.30	5mg5:C, 5mg5:O, 5mg5:R
12	7aih:Aq	258	47	0.0890	0.0659	0.3617	3.0	7ane:Aq
13	6p8j:C	300	73	0.0995	0.0633	0.2603	3.6	6p8j:A, 6p8j:B, 6p8j:D

[Back]