PSLRTQPSLYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPINGPGPDFDLRDGYPDRYQPRDEEVQERLDHL
LRWVLEHRNQLEGGPGWLAGATVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPAARAQRLARPPLLRELMY
MGYKFEQYMCADKPGGSPDPSGEVNTNVAYCSVLRSRLGNHPLLFSGEVDCLNPQAPCTQPPSCYVELKTSKEMHSPGQW
RSFYRHKLLKWWAQSFLPGVPHVVAGFRNPEGFVCSLKTFPTMEMFENVRNDREGWNPSVCMNFCAAFLSFAQSTVVQDD
PRLVHLFSWEPGGPVTVSVHRDAPYAFLPSWYVETMTQ
The query sequence (length=358) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6aix:A | 358 | 358 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 6aiy:A, 3fqi:A, 3fqj:A, 4j7l:A, 4j7m:A, 4j7n:A, 5uli:A, 6wre:A, 6wuf:A, 6wuk:A |
2 | 3fqd:B | 332 | 354 | 0.2793 | 0.3012 | 0.2825 | 4.90e-33 | 3fqg:A, 6wui:A |
3 | 6wug:A | 312 | 342 | 0.2654 | 0.3045 | 0.2778 | 6.79e-30 | |
4 | 5bud:A | 391 | 343 | 0.2514 | 0.2302 | 0.2624 | 1.74e-26 | 5bud:B |
5 | 5ulj:B | 386 | 340 | 0.2514 | 0.2332 | 0.2647 | 1.52e-24 | 5ulj:A |
6 | 5bte:B | 368 | 295 | 0.2123 | 0.2065 | 0.2576 | 2.15e-14 | 5bte:A |
7 | 8k5p:O | 346 | 278 | 0.1955 | 0.2023 | 0.2518 | 5.47e-14 | |
8 | 4gpu:A | 331 | 104 | 0.0726 | 0.0785 | 0.2500 | 0.024 | |
9 | 6ywe:H | 183 | 85 | 0.0670 | 0.1311 | 0.2824 | 0.092 | 6yws:H, 6ywv:H, 6ywx:H, 6ywy:H |
10 | 8t85:A | 335 | 65 | 0.0503 | 0.0537 | 0.2769 | 2.0 | 7lcm:A |
11 | 5xct:A | 167 | 122 | 0.0978 | 0.2096 | 0.2869 | 2.8 | 5xcq:A, 5xcr:A, 5xcr:D |
12 | 7kya:A | 1174 | 75 | 0.0559 | 0.0170 | 0.2667 | 2.8 | 7ky5:A, 7ky7:A, 7ky8:A, 7ky9:A |
13 | 3suc:A | 767 | 75 | 0.0559 | 0.0261 | 0.2667 | 3.6 | 3gq7:A, 3gq8:A, 3gqa:A, 3gqk:A |
14 | 7ste:A | 468 | 67 | 0.0559 | 0.0427 | 0.2985 | 8.8 | 8fs4:A, 7sh2:A |
15 | 5jul:A | 1233 | 125 | 0.0782 | 0.0227 | 0.2240 | 8.9 | 5jul:B, 5jul:C, 5jul:D, 5jul:E, 5jul:F, 5jul:G, 5jul:H, 5jul:I, 5jul:J, 5jul:K, 5jul:L, 5jul:M, 5jul:N, 5jul:O, 5jul:P |