PRYYEYRHVVGFEETNLVGNVYYVNYLRWQGRCREMFLYEHAPEILDELRADLKLFTLKAECEFFAELAPFDRLAVRMRL
VELTQTQMELGFDYLRLGGDDLLVARGRQRIACMRGPNGRTEPVRVPAGLVRAFAPFRSAT
The query sequence (length=141) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2w3x:E | 144 | 141 | 1.0000 | 0.9792 | 1.0000 | 6.16e-102 | 2w3x:A, 2w3x:C, 2w3x:D, 2w3x:F |
2 | 2xem:B | 136 | 133 | 0.4610 | 0.4779 | 0.4887 | 1.93e-39 | |
3 | 5ncc:A | 578 | 51 | 0.1064 | 0.0260 | 0.2941 | 0.81 | 7av4:AAA, 5ncc:B, 5ncc:C, 5ncc:D, 5ncc:E, 5ncc:F, 7r33:A, 7r33:B, 7r34:A, 7r34:B, 7r35:A, 7r35:B, 7r36:A, 7r36:B, 6yru:AAA, 6yrv:AAA, 6yrx:AAA, 6yrz:AAA, 6ys1:AAA, 6ys2:AAA, 6zh7:A, 6zh7:B |
4 | 5kl9:A | 134 | 127 | 0.2057 | 0.2164 | 0.2283 | 3.1 | 5kl9:D, 5t06:A, 5t06:C, 5t07:A, 5t07:D, 5t07:B, 5t07:C |
5 | 3fa5:A | 276 | 57 | 0.1135 | 0.0580 | 0.2807 | 4.2 | 3fa5:B |
6 | 7pci:A | 345 | 70 | 0.1277 | 0.0522 | 0.2571 | 4.8 | 7pcc:A, 7pcc:B, 7pce:A, 7pcg:A, 7pcg:B, 7pcl:A, 7pcl:B, 7pcm:A, 7pcm:B, 7pcn:A, 7pcn:B, 7pco:A, 7pco:B, 7pct:A, 7pct:B |
7 | 1nw1:A | 365 | 27 | 0.0780 | 0.0301 | 0.4074 | 4.9 | 1nw1:B |
8 | 6hiv:DX | 141 | 57 | 0.1206 | 0.1206 | 0.2982 | 5.0 | 6hiw:DX, 6hiz:DX, 7pua:DX, 7pub:DX, 6sg9:DX |