PRWQETAYVLGNYKTEPCKKPPRLCRQGYACPYYHNSKDRRRSPRKHKYRSSPCPNVKHGDEWGDPGKCENGDACQYCHT
RTEQQFHPEIYKSTKCNDMQQAGSCPRGPFCAFAHIEPPPL
The query sequence (length=121) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5elk:A | 121 | 121 | 1.0000 | 1.0000 | 1.0000 | 1.95e-88 | |
2 | 1rgo:A | 70 | 56 | 0.1653 | 0.2857 | 0.3571 | 7.53e-04 | |
3 | 1rgo:A | 70 | 73 | 0.1653 | 0.2857 | 0.2740 | 2.0 | |
4 | 1rgo:A | 70 | 25 | 0.0826 | 0.1429 | 0.4000 | 4.4 | |
5 | 6nzl:A | 78 | 63 | 0.1488 | 0.2308 | 0.2857 | 0.047 | |
6 | 6nzl:A | 78 | 78 | 0.1736 | 0.2692 | 0.2692 | 6.1 | |
7 | 5elh:A | 142 | 54 | 0.1653 | 0.1408 | 0.3704 | 0.064 | 5elh:B |
8 | 7k95:A | 53 | 53 | 0.1488 | 0.3396 | 0.3396 | 0.26 | 7zyh:A, 7zyh:D, 7zyh:G, 7zyh:J |
9 | 6o5f:A | 417 | 48 | 0.1322 | 0.0384 | 0.3333 | 3.3 | 6o5f:B |
10 | 7liu:A | 442 | 33 | 0.0992 | 0.0271 | 0.3636 | 3.5 | 6cz5:A, 5e7j:A, 5e7m:A, 2i4i:A, 7liu:B, 4px9:A, 4px9:B, 4px9:C, 4pxa:A, 8ssw:A, 8ssw:B |
11 | 7r8e:A | 548 | 36 | 0.1157 | 0.0255 | 0.3889 | 3.9 | 7fdv:A, 7fdv:D, 7oz1:A, 7oz1:B, 7r8d:A, 7r8d:B, 7r8e:B |
12 | 7tj9:A | 1111 | 23 | 0.0826 | 0.0090 | 0.4348 | 5.2 | |
13 | 6imj:A | 412 | 18 | 0.0661 | 0.0194 | 0.4444 | 7.2 | 6imj:B, 6imk:A, 6iml:A, 6imn:B, 6imn:A |
14 | 8gz2:B | 1174 | 53 | 0.1322 | 0.0136 | 0.3019 | 8.8 | 8gz1:B |
15 | 8fhd:A | 1294 | 53 | 0.1322 | 0.0124 | 0.3019 | 8.8 | |
16 | 1m9o:A | 40 | 25 | 0.0826 | 0.2500 | 0.4000 | 9.5 | |
17 | 7dco:M | 176 | 36 | 0.0992 | 0.0682 | 0.3333 | 9.6 | 5gm6:a |