PRTVMVNLNIHYYDRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHSPNSFR
LEKILVSVGCTCVTPI
The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5vb9:A | 108 | 99 | 1.0000 | 0.8889 | 0.9697 | 9.31e-67 | 7ama:A, 7ama:B, 7amg:A, 7amg:B, 7amg:C, 7amg:D, 8cdg:A, 8cdg:B, 8dyf:A, 8dyf:B, 8dyg:A, 8dyg:B, 8dyh:A, 8dyh:B, 8dyi:A, 8dyi:B, 5hhv:A, 5hhx:A, 5hi3:A, 5hi3:B, 5hi4:A, 5hi4:B, 5hi5:A, 5hi5:B, 8usr:A, 8usr:B, 8usr:D, 5vb9:B |
2 | 8uss:A | 107 | 108 | 0.9167 | 0.8224 | 0.8148 | 2.65e-56 | |
3 | 3jvf:B | 104 | 91 | 0.5521 | 0.5096 | 0.5824 | 2.39e-33 | |
4 | 8htu:H | 95 | 26 | 0.1042 | 0.1053 | 0.3846 | 0.40 | 7ksq:H, 7kux:H, 6l35:H, 7xqp:H |
5 | 8opp:A | 670 | 45 | 0.1354 | 0.0194 | 0.2889 | 0.67 | |
6 | 8opt:A | 783 | 45 | 0.1354 | 0.0166 | 0.2889 | 0.68 | 8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B |
7 | 8jjm:A | 484 | 43 | 0.1458 | 0.0289 | 0.3256 | 5.2 | 8jjm:B |
8 | 2iag:A | 471 | 51 | 0.1354 | 0.0276 | 0.2549 | 5.3 | 3b6h:A, 3b6h:B, 2iag:B |
9 | 6z1p:AR | 274 | 58 | 0.1979 | 0.0693 | 0.3276 | 6.4 | |
10 | 4pu5:A | 438 | 20 | 0.0938 | 0.0205 | 0.4500 | 8.5 | |
11 | 4iru:C | 296 | 37 | 0.1354 | 0.0439 | 0.3514 | 8.7 | |
12 | 6wb7:A | 296 | 52 | 0.1562 | 0.0507 | 0.2885 | 9.3 | 6wb7:B, 6wb7:C, 6wb7:D |