PQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNV
TM
The query sequence (length=82) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4uyk:A | 82 | 82 | 1.0000 | 1.0000 | 1.0000 | 4.36e-58 | 5aox:A, 5aox:D, 1e8o:A, 1e8o:C, 6frk:w, 3jaj:S1, 3jan:S1, 7nfx:w, 7obr:w, 6r6g:AD, 1ry1:C, 4ue5:E, 4uyj:A, 4uyj:C |
2 | 8je0:A | 378 | 36 | 0.1951 | 0.0423 | 0.4444 | 0.050 | 8je0:B, 8je0:C, 8je0:D |
3 | 7bss:A | 816 | 46 | 0.1463 | 0.0147 | 0.2609 | 7.1 | 7bsu:A, 7bsv:A, 7bsw:A, 7vsg:A |
4 | 7bsp:A | 1028 | 46 | 0.1463 | 0.0117 | 0.2609 | 9.1 | 7bsq:A, 7vsh:A |
5 | 7xz4:A | 203 | 28 | 0.1220 | 0.0493 | 0.3571 | 9.1 | |
6 | 6lkn:A | 1064 | 46 | 0.1463 | 0.0113 | 0.2609 | 9.5 | 6lkn:E, 6lkn:I, 6lkn:M |