PQPPKVLSTPLEIAANLRQLQESHDPLIITFHDRSHRFQSYVVHVDRESNTLALDEMIPRDGEKFIENGEHFRVEGFHDG
VRIAWECDHALKISEVDGHRCYSGPLPQEVTYHQRRNAFRAALKLSQLVDIILDGAHLKGNGAMRGKLLDISATGCKLRF
EGNVEDRLQLGQVYERFKAGNPLGLVDTMVELRHLHYEERINTTFAGVRFHNLSGQAQRKIESFVYQLQRE
The query sequence (length=231) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3kyf:A | 231 | 231 | 1.0000 | 1.0000 | 1.0000 | 7.29e-175 | |
2 | 5y6f:A | 226 | 223 | 0.2035 | 0.2080 | 0.2108 | 0.002 | |
3 | 5kow:A | 474 | 49 | 0.0779 | 0.0380 | 0.3673 | 0.081 | 6c7s:A, 5kox:A |
4 | 7nra:BBB | 328 | 44 | 0.0693 | 0.0488 | 0.3636 | 0.60 | 7nra:AAA |
5 | 3n29:A | 371 | 43 | 0.0693 | 0.0431 | 0.3721 | 1.2 | 3n29:B |
6 | 8snj:A | 370 | 58 | 0.0693 | 0.0432 | 0.2759 | 1.7 | 8sng:A, 8sng:B, 8snj:B, 8snj:C, 8snj:D, 8snj:E, 8snj:F, 8su6:A, 8su6:B |
7 | 5cxw:A | 376 | 85 | 0.0779 | 0.0479 | 0.2118 | 2.1 | |
8 | 2ppl:A | 449 | 65 | 0.0823 | 0.0423 | 0.2923 | 4.7 | |
9 | 5y6g:A | 131 | 126 | 0.1299 | 0.2290 | 0.2381 | 5.5 | |
10 | 2v43:A | 261 | 39 | 0.0649 | 0.0575 | 0.3846 | 5.8 | |
11 | 2v42:A | 290 | 39 | 0.0649 | 0.0517 | 0.3846 | 6.1 | 3m4w:A, 3m4w:B, 2v42:B, 2v43:B |
12 | 1exw:A | 279 | 35 | 0.0606 | 0.0502 | 0.4000 | 8.2 | |
13 | 6eki:A | 222 | 41 | 0.0606 | 0.0631 | 0.3415 | 8.9 | 6eki:B, 6eki:C, 6eki:D, 6eki:E, 6eki:F |
14 | 4cyb:J | 173 | 58 | 0.0736 | 0.0983 | 0.2931 | 9.8 | 4cyb:A, 4cyb:B, 4cyb:C, 4cyb:D, 4cyb:E, 4cyb:F, 4cyb:G, 4cyb:H, 4cyb:I, 4cyb:K, 4cyb:L |