PPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPT
The query sequence (length=53) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6qx9:1K | 201 | 53 | 1.0000 | 0.2637 | 1.0000 | 3.10e-33 | 7b0y:b, 4pjo:K, 4pjo:k, 4pjo:N, 4pjo:n, 8r08:1K, 7vpx:O |
2 | 4oth:A | 306 | 48 | 0.3208 | 0.0556 | 0.3542 | 0.52 | 4oti:A |
3 | 2yg3:B | 450 | 31 | 0.2264 | 0.0267 | 0.3871 | 1.5 | 2yg3:A, 2yg4:A, 2yg4:B, 2yg5:A, 2yg6:A, 2yg6:B, 2yg7:A, 2yg7:B |
4 | 1te2:A | 218 | 34 | 0.2642 | 0.0642 | 0.4118 | 1.8 | 1te2:B |
5 | 4zad:A | 511 | 27 | 0.2264 | 0.0235 | 0.4444 | 2.5 | 4zad:B |
6 | 8e9h:D | 407 | 17 | 0.1698 | 0.0221 | 0.5294 | 2.8 | 8e9g:D |
7 | 7v4x:A | 529 | 19 | 0.1321 | 0.0132 | 0.3684 | 4.4 | 6a37:A, 7v50:A, 7v51:A |
8 | 8rcw:A | 205 | 33 | 0.1698 | 0.0439 | 0.2727 | 6.9 | 8rcw:B |
9 | 7cgm:A | 349 | 14 | 0.1321 | 0.0201 | 0.5000 | 7.1 | 7cgf:A, 7cgg:A, 7cgh:A, 7cgi:A, 7cgj:A, 7cgk:A, 7cgl:A, 6nod:A, 6nod:B, 6nod:C |
10 | 8e72:B | 598 | 53 | 0.3019 | 0.0268 | 0.3019 | 7.2 | 8dhw:A, 8dhw:B, 8e72:A |