Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
PPLPDIPEGSPKLMEPLVKFVSDELGMDDLKLLDLREIDPPPALGPEVLMLFGTARSERHLHVSADRLVRWLRNRGVTAK
ADGLLGRNELKTKLRRKARKAKLLGTTGLPSGADDGITTGWICVNLGTLGWSDMEMEFKGFGVPQSGTTLVVQLMTETRR
EELALEKLWSGILRRSLERQDKIAGK

The query sequence (length=186) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6ywv:n 186 186 1.0000 1.0000 1.0000 2.67e-132
2 6yxy:EI 275 141 0.1935 0.1309 0.2553 0.097 7aoi:XJ
3 4c1p:A 703 68 0.1183 0.0313 0.3235 0.26
4 6n20:D 501 60 0.1129 0.0419 0.3500 0.41 6b86:A, 6b86:B, 6b86:C, 6b86:D, 8fu2:A, 8fu2:B, 8fu2:C, 8fu2:D, 8fu5:A, 8fu5:B, 8fu5:C, 8fu5:D, 6n1y:A, 6n1y:B, 6n1y:C, 6n1y:D, 6n20:A, 6n20:C, 6n20:B, 6n21:A, 6n21:B, 6n21:C, 6n21:D, 8srl:A, 8srl:B, 8srl:C, 8srl:D, 7t8p:A, 7t8p:B, 7t8p:C, 7t8p:D, 7t8q:A, 7t8q:B, 7t8q:C, 7t8q:D, 5u8x:A, 5u8x:B, 5u8x:C, 5u8x:D, 5u8y:A, 5u8y:B, 5u8y:C, 5u8y:D, 5u8z:A, 5u8z:B, 5u8z:C, 5u8z:D, 5u90:A, 5u90:B, 5u90:C, 5u90:D, 5u97:A, 5u97:B, 5u97:C, 5u97:D
5 1yht:A 344 111 0.1452 0.0785 0.2432 0.44
6 7am2:CB 135 39 0.0699 0.0963 0.3333 0.71
7 7am2:CB 135 21 0.0591 0.0815 0.5238 2.9
8 7o9k:u 133 137 0.1667 0.2331 0.2263 1.4 7a5h:u, 7a5j:u, 8k2b:u, 7o9m:u, 7odr:u, 7ods:u, 7odt:u, 7of0:u, 7of2:u, 7of3:u, 7of5:u, 7of7:u, 7oi7:u, 7oi8:u, 7oi9:u, 7oic:u, 7oid:u, 7oie:u, 5ool:u, 5oom:u, 7pd3:u, 8pk0:u, 7po4:za, 8qsj:u, 8qu5:u
9 7co7:D 329 127 0.1882 0.1064 0.2756 2.0 7co2:A, 7co3:A, 7co5:H, 7co5:B, 7co5:D, 7co5:F, 7co5:J, 7co5:L
10 7ase:T 132 61 0.1237 0.1742 0.3770 2.9
11 7pi0:W 44 24 0.0753 0.3182 0.5833 4.6 7pi0:w, 7pin:w, 7pin:W1, 7pin:w1, 7piw:W, 7piw:w1
12 8aas:B 178 64 0.1290 0.1348 0.3750 7.7 8oej:B, 8oej:H, 8oel:B, 8oel:H
13 3f2b:A 994 44 0.0806 0.0151 0.3409 7.7 3f2c:A, 3f2d:A
14 8q5u:D 788 35 0.0860 0.0203 0.4571 9.7 6e58:A, 6e58:B, 6mds:A, 6mds:B, 6mdv:A, 6mdv:B, 8q5u:F, 8q5u:E

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218