PPGLCPRCKKGYHWKSECKSKFDKDGNPLPP
The query sequence (length=31) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1dsv:A | 31 | 31 | 1.0000 | 1.0000 | 1.0000 | 2.83e-17 | |
2 | 1cl4:A | 32 | 30 | 0.7097 | 0.6875 | 0.7333 | 8.85e-12 | |
3 | 8opt:A | 783 | 31 | 0.3871 | 0.0153 | 0.3871 | 0.13 | 8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B |
4 | 5iz8:A | 343 | 23 | 0.2258 | 0.0204 | 0.3043 | 0.97 | 5b6g:A, 7f6m:A, 7f7o:A, 8gsj:A, 5iz6:A, 5iz8:B, 5iz9:A, 5iza:A, 3nmx:A, 3nmx:B, 3nmx:C, 3qhe:A, 3qhe:C, 4yje:A, 4yjl:A, 4yjl:C, 4yjl:D, 4yjl:E, 4yjl:B, 4yjl:F, 4yk6:A, 5z8h:A |
5 | 5o9z:H | 413 | 22 | 0.3548 | 0.0266 | 0.5000 | 1.5 | 6ahd:L, 8h6e:4D, 8h6k:4D, 8h6l:4D, 2ozb:B, 2ozb:E, 8q7n:L, 8qo9:L, 8qoz:L, 8qp8:L, 8qp9:L, 8qpa:L, 8qpb:L, 8qpe:L, 8qpk:L, 6qw6:4C, 6qx9:4C, 8qxd:L, 8qzs:L, 8r08:L, 8r09:L, 8r0b:L, 8rm5:L, 3siu:B, 3siu:E, 3siv:B, 3siv:E, 3siv:H, 3siv:K, 8y6o:L |
6 | 8r0a:L | 292 | 23 | 0.3871 | 0.0411 | 0.5217 | 1.9 | 6ah0:L |
7 | 6t40:A | 271 | 32 | 0.3548 | 0.0406 | 0.3438 | 3.5 | 5osn:A, 6t48:A, 6t4c:A |
8 | 3me4:A | 169 | 12 | 0.2258 | 0.0414 | 0.5833 | 3.5 | 3me2:R, 3me4:B |
9 | 5wch:A | 350 | 24 | 0.3226 | 0.0286 | 0.4167 | 4.1 | 5wch:B, 5wch:C, 5wch:D |
10 | 3k21:A | 178 | 21 | 0.3226 | 0.0562 | 0.4762 | 5.4 | |
11 | 6vpb:B | 324 | 11 | 0.2581 | 0.0247 | 0.7273 | 5.6 | |
12 | 6rwl:B | 252 | 14 | 0.1613 | 0.0198 | 0.3571 | 7.1 | 6rwl:C, 6rwl:J, 6rwl:K, 6rwm:B, 6rwm:C, 6rwm:J, 6rwm:K, 6rwn:K, 6rwn:J, 6rwn:C, 6rwn:B, 6rwo:K, 6rwo:J, 6rwo:C, 6rwo:B |
13 | 7p01:A | 572 | 20 | 0.2903 | 0.0157 | 0.4500 | 7.3 | 7p01:B, 7p07:A, 7p07:B |
14 | 8aaf:e | 1527 | 32 | 0.3871 | 0.0079 | 0.3750 | 8.4 | 8agt:e, 8agu:e, 8agv:e, 8agw:e, 8agx:e, 8agz:e |
15 | 3th0:A | 552 | 11 | 0.2581 | 0.0145 | 0.7273 | 8.5 | 1tyu:A, 1tyw:A, 1tyx:A |
16 | 6rcl:B | 148 | 24 | 0.3548 | 0.0743 | 0.4583 | 9.1 | 6j7y:A, 6j7z:A, 6j80:A, 6rcn:B |
17 | 4a2c:A | 346 | 23 | 0.3226 | 0.0289 | 0.4348 | 9.3 | 4a2c:B, 4uej:A, 4uej:B, 4uek:A, 4uek:B, 4ueo:A, 4ueo:B |
18 | 1f1u:A | 322 | 17 | 0.2581 | 0.0248 | 0.4706 | 9.9 | 1f1r:A, 1f1r:B, 1f1u:B, 1f1v:A, 1f1v:B |
19 | 7fh6:A | 653 | 10 | 0.2581 | 0.0123 | 0.8000 | 10.0 | 7fh7:A, 7fh8:A, 7ron:A, 7roo:A |