BioLiP

>protein
PNPYERGPDPTEDSIEAIRGPFSVATERVSSFASGFGGGTIYYPRETDEGTFGAVAVAPGFTASQGSMSWYGERVASHGF
IVFTIDTNTRLDAPGQRGRQLLAALDYLVERSDRKVRERLDPNRLAVMGHAMGGGGSLEATVMRPSLKASIPLTPWHLDK
TWGQVQVPTFIIGAELDTIAPVSTHAKPFYESLPSSLPKAYMELCGATHFAPNIPNTTIAKYVISWLKRFVDEDTRYSQF
LCPNPTDRAICEYRSTCPYKLN

The query sequence (length=262) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5zrq:A	263	259	0.9695	0.9658	0.9807	0.0	7cef:A, 7cef:B, 7ceh:A, 7cts:A, 8ibl:A, 8ibl:B, 8ibm:A, 8ibm:B, 4wfj:A, 4wfk:A, 5zno:A, 5zno:B, 5zrr:A, 5zrs:A
2	5lui:A	264	264	0.6527	0.6477	0.6477	2.93e-127	5luk:A, 5lul:A, 7xtt:B, 7xtv:A, 7xtv:B
3	8xho:A	262	261	0.6565	0.6565	0.6590	2.05e-124	8xho:B
4	7qjt:A	267	261	0.6374	0.6255	0.6398	6.33e-124
5	8a2c:A	268	261	0.6450	0.6306	0.6475	1.71e-122	8a2c:B
6	6aid:A	261	262	0.6298	0.6322	0.6298	3.11e-122	3wyn:A, 3wyn:B
7	7yko:A	259	262	0.6221	0.6293	0.6221	4.52e-118
8	8bra:B	259	259	0.6527	0.6602	0.6602	7.28e-115	8brb:A, 8brb:B, 7w6c:A, 7w6c:B, 7w6o:A, 7w6o:B, 7w6q:B
9	7vvc:B	263	255	0.5649	0.5627	0.5804	1.14e-103	8jmo:A, 8jmo:B, 8jmp:A, 8qrj:A, 7vvc:A, 7vve:A, 7vve:B, 7w45:A, 7w45:B
10	7vmd:A	266	265	0.4618	0.4549	0.4566	6.92e-77	7vme:A
11	7vpb:A	270	270	0.4809	0.4667	0.4667	3.16e-76	7vpb:B
12	8ian:A	270	271	0.4809	0.4667	0.4649	4.12e-75	8ian:B
13	8d1d:A	262	258	0.4580	0.4580	0.4651	4.59e-69	8d1d:C, 8h5m:A, 5xh2:A, 5xh3:A, 7xtw:A
14	3f98:A	377	82	0.0725	0.0504	0.2317	0.014	3f97:A, 3f97:B, 3f98:B, 3f98:C, 3f9c:A, 3f9c:B, 5i8p:A, 5i8p:B, 5i9i:A, 5i9i:B, 5jad:A, 5jah:A, 5jal:A, 5jan:A, 5jao:A, 5jap:A, 5jar:A, 5jas:A, 5jat:A, 5jau:A, 5lp1:A, 5lyy:A, 5lz2:A, 5lz4:A, 5lz5:A, 5lz7:A, 5lz8:A, 5lz9:A, 6m06:A, 6m06:B, 6m07:A, 6m07:B, 6m08:B, 5ye7:B, 5ye7:A, 5ye8:B, 5ye8:A, 5ye9:A, 5ye9:B, 5yea:A, 5yea:B
15	3fcx:B	275	121	0.1069	0.1018	0.2314	0.020	3fcx:A
16	7cof:A	320	86	0.0954	0.0781	0.2907	0.072	7cog:A, 7cog:B, 7cog:C, 7cog:D, 1hqd:A, 2lip:A, 3lip:A, 4lip:D, 4lip:E, 5lip:A, 2nw6:A, 1oil:A, 1oil:B, 1ys1:X, 1ys2:X
17	1tah:B	318	86	0.0954	0.0786	0.2907	0.12	1cvl:A, 2es4:A, 2es4:B, 1qge:E, 1tah:A, 1tah:C, 1tah:D
18	8k9t:A	961	196	0.1947	0.0531	0.2602	0.32	8k9r:A
19	6w32:B	288	64	0.0840	0.0764	0.3438	0.41	6w32:A, 6w32:C
20	8k9q:A	927	196	0.1908	0.0539	0.2551	0.75
21	1q0r:A	297	63	0.0763	0.0673	0.3175	0.76	1q0z:A
22	7amv:W	637	41	0.0611	0.0251	0.3902	1.1
23	3i6y:A	278	91	0.1031	0.0971	0.2967	1.8	3i6y:B, 3s8y:A
24	3fcy:A	317	45	0.0534	0.0442	0.3111	1.9	3fcy:C
25	8b5q:B	365	50	0.0611	0.0438	0.3200	2.0	8b5q:A, 8b5s:A, 8b5s:B, 8b62:A, 8b62:B, 8b63:A, 8b63:B
26	1ss9:A	280	77	0.0725	0.0679	0.2468	3.8	1g9r:A, 1ga8:A
27	7oon:B	185	64	0.0763	0.1081	0.3125	4.9	7oon:A
28	7auy:B	245	100	0.1221	0.1306	0.3200	5.8
29	1ibj:A	380	156	0.1336	0.0921	0.2244	6.2	1ibj:C
30	7at3:A	295	100	0.1221	0.1085	0.3200	7.1	7at3:B, 7at4:A, 7atd:B, 7atf:A, 7atf:B, 7atq:A, 7auy:A, 7av5:AAA, 7av5:BBB, 7nb5:A
31	3e4d:A	278	27	0.0382	0.0360	0.3704	8.3	3e4d:B, 3e4d:C, 3e4d:E, 3e4d:D, 3e4d:F

[Back]