PMRVLKYAILGLLRKGELSGYDITSYFKEELGQFWSAKHSQIYPELKKLTDEGFITFRTTIQGTKLEKKMYTLTDSGKQE
LHDWLIRHQPIPETVKDEFMLKAYFISSLSRQEASDLFTDQLLKRKAKLSDLQGSYEKLMAPMSFSSPDFGHYLVLTKAL
EREKNYVSWLESILAMID
The query sequence (length=178) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5x11:E | 181 | 180 | 0.9944 | 0.9779 | 0.9833 | 1.34e-127 | 5x11:A, 5x11:B, 5x11:D, 5x11:C, 5x11:F, 5x11:H, 5x14:A |
2 | 5z7b:B | 197 | 180 | 0.2528 | 0.2284 | 0.2500 | 3.11e-07 | 6lg2:A, 6lg2:B, 5z7b:A |
3 | 1q1w:A | 422 | 71 | 0.0899 | 0.0379 | 0.2254 | 0.23 | 3lb8:A, 3lb8:B, 1q1r:A, 1q1r:B, 1q1w:B |
4 | 2fkz:A | 155 | 99 | 0.1573 | 0.1806 | 0.2828 | 0.68 | 2fkz:B, 2fkz:D, 2fkz:C, 2fkz:E, 2fkz:F, 2fkz:G, 2fkz:H, 2fl0:A, 2fl0:F, 2fl0:B, 2fl0:D, 2fl0:C, 2fl0:E, 2fl0:G, 2fl0:H, 1sof:A, 1sof:B, 1sof:C, 1sof:D, 1sof:E, 1sof:F, 1sof:G, 1sof:H |
5 | 4lt6:A | 467 | 52 | 0.0899 | 0.0343 | 0.3077 | 0.88 | 4lt6:B |
6 | 5ven:A | 382 | 69 | 0.1011 | 0.0471 | 0.2609 | 1.0 | 5ven:B, 5veo:A |
7 | 7oqh:D | 364 | 55 | 0.0787 | 0.0385 | 0.2545 | 5.3 | 7oqh:A, 7oqh:B, 7oqh:C, 7oqh:E, 7oqh:F |