BioLiP

>protein
PMRSEPLRKKKKVDPKKDQEAKERLKRKIRKLEKATQLIPIEDFITPLKFLDKARERPQVELTFEETERRALLLKKWSLY
KQQERKMERDTIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTPPIPNYQPPEGRYNDITKVYTQVEF
KR

The query sequence (length=162) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7a5f:A	162	162	1.0000	1.0000	1.0000	6.14e-114	7a5g:A, 7a5h:8, 7a5i:83, 7a5j:8, 7a5k:A, 8any:8, 6i9r:8, 3j7y:8, 3j9m:8, 8k2a:Ln, 8k2b:Ln, 7l08:8, 7l20:8, 6nu2:8, 6nu3:8, 7o9k:8, 7o9m:8, 7odr:8, 7ods:8, 7odt:8, 7of0:8, 7of2:8, 7of3:8, 7of4:8, 7of5:8, 7of6:8, 7of7:8, 7og4:8, 7oi7:8, 7oi8:8, 7oi9:8, 7oia:8, 7oib:8, 7oic:8, 7oid:8, 7oie:8, 8oir:Bp, 8oit:Bp, 5ool:8, 5oom:8, 7pd3:8, 8pk0:8, 7po4:8, 7qi4:8, 7qi5:8, 7qi6:8, 8qsj:8, 8qu5:8, 6vlz:8, 6vmi:8, 8xt0:Ln, 8xt1:Ln, 8xt2:Ln, 8xt3:Ln, 6zm5:8, 6zm6:8, 6zs9:8, 6zsa:8, 6zsb:8, 6zsc:8, 6zsd:8, 6zse:8, 6zsg:8
2	8oin:Bp	143	143	0.6667	0.7552	0.7552	6.24e-75	5aj4:Bd, 6gaw:Bd, 6gb2:Bd, 7nqh:Bd, 7nql:Bd, 7nsh:Bd, 7nsi:Bd, 7nsj:Bd, 8oiq:Bp, 6ydp:Bd, 6ydw:Bd
3	3j6b:2	113	95	0.1543	0.2212	0.2632	0.12	5mrc:2, 5mre:2, 5mrf:2
4	1eu4:A	204	70	0.0988	0.0784	0.2286	0.16
5	4aos:A	523	79	0.1481	0.0459	0.3038	0.45	4aox:A, 4ap1:A, 4ap3:A
6	3ge1:A	499	33	0.0802	0.0261	0.3939	1.3	3ge1:B, 3ge1:C, 3ge1:D
7	4obi:A	87	26	0.0679	0.1264	0.4231	2.1
8	4hka:A	345	40	0.0864	0.0406	0.3500	3.1
9	8fl2:NC	511	39	0.0741	0.0235	0.3077	4.8	8fkz:NC, 8fl0:NC, 8fl3:NC, 8fl4:NC, 8idt:A, 8idy:A, 8ie3:A, 8ine:A, 8inf:A, 8ink:w, 8ipd:w, 8ipx:w, 8ipy:w, 8ir1:w, 8ir3:w
10	4xzp:A	148	26	0.0741	0.0811	0.4615	8.8	5duu:A, 5duu:B, 5duu:C, 5duu:D, 5duv:A, 5duv:B, 5duv:C, 5duv:D, 5duw:A, 5duw:B, 5duw:C, 5duw:D, 5dux:B, 5dux:D, 5dux:A, 5dux:C
11	7ed6:A	203	80	0.1667	0.1330	0.3375	9.8	7ed6:B, 7ed9:A, 7ed9:B

[Back]