BioLiP

>protein
PLKEKKLLEVKLGELPSWILMRDFTPSGIAGAFQRGYYRYYNKYVNVKKGSIAGLSMVLAAYVFLNYCRSYKELKHERLR
KYH

The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6j54:f	87	83	0.9277	0.8851	0.9277	1.30e-54	6zbb:f, 6zmr:f, 6zpo:f, 6zqm:f, 6zqn:f
2	6td5:I	219	38	0.1687	0.0639	0.3684	1.0	6td5:i
3	7dzz:B	268	18	0.1084	0.0336	0.5000	2.8	7dt0:A, 7dt0:B, 7dt0:C, 7dt0:D, 7dt0:E, 7dt0:F, 7dt0:G, 7dzz:A, 7e00:A, 7e00:B, 7e01:A, 7e06:A, 7e06:B, 7e07:A, 7e07:B, 7e08:A, 7e09:A, 8h7v:A, 8h7v:B, 8h7y:A, 8h7y:B, 8h81:A, 8h85:A
4	7dt0:H	241	18	0.1084	0.0373	0.5000	2.9
5	1m74:A	802	41	0.1807	0.0187	0.3659	3.9	2ibm:A, 6itc:A, 3jv2:A, 3jv2:B, 1tf2:A, 7xha:A, 7xhb:A
6	5eul:A	746	41	0.1807	0.0201	0.3659	4.1
7	6wq2:A	154	62	0.2169	0.1169	0.2903	7.6	6wq2:B, 6wq2:C, 6wq2:D, 6wq2:E, 6wq2:F, 6wq2:G, 6wq2:H, 6wq2:I, 6wq2:J, 6wq2:K, 6wq2:L, 6wq2:M, 6wq2:N, 6wq2:P, 6wq2:R, 6wq2:T
8	3e80:C	747	30	0.1325	0.0147	0.3667	9.0	3e7j:A, 3e7j:B, 3e80:A, 3e80:B, 2fuq:B, 2fuq:A, 2fut:A, 2fut:B
9	7cn3:C	349	20	0.1205	0.0287	0.5000	9.3	7cn3:A, 7cn3:B, 7cn3:D, 7cn3:E, 7cn3:F, 7cnt:A, 7cnt:B, 7cnt:C, 7cnt:D, 7cnt:E, 7cnt:F, 7cup:A, 7cup:B, 7cup:C, 7cup:D, 7cup:E, 7cup:F

[Back]