PLELRPGEYRVLLCVDIGETRPELLRELQRLHVTHTVRKLHVGDFVWVAQETNPRDPANPGELVLDHIVERKRLDDLCSS
IIDGRFREQKFRLKRCGLERRVYLVEELSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALLTRGLQRLYQGHTLR
SRPWGPNPLCSLLTFSDFNA
The query sequence (length=180) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4p0q:A | 285 | 192 | 1.0000 | 0.6316 | 0.9375 | 4.69e-125 | 9f99:A, 9f99:G, 9f99:C, 9f99:E, 9f9a:A, 9f9a:G, 9f9a:C, 9f9a:E, 9f9k:A, 9f9l:A, 9f9l:C, 9f9m:A, 9f9m:C, 4p0p:A, 4p0r:A, 4p0r:C, 4p0s:A, 4p0s:G, 4p0s:E, 4p0s:C |
2 | 1j24:A | 133 | 96 | 0.1778 | 0.2406 | 0.3333 | 4.55e-05 | 1j25:A |
3 | 2bgw:A | 219 | 143 | 0.2333 | 0.1918 | 0.2937 | 0.007 | |
4 | 8u2o:A | 289 | 60 | 0.1000 | 0.0623 | 0.3000 | 0.94 | 9cmz:A, 9cmz:B, 9cmz:C, 8u2o:B |
5 | 1zgl:M | 178 | 54 | 0.0889 | 0.0899 | 0.2963 | 1.7 | |
6 | 2fah:C | 608 | 48 | 0.1222 | 0.0362 | 0.4583 | 2.5 | 2faf:A, 2faf:B, 2fah:D, 2fah:A, 2fah:B, 2qzy:A, 2qzy:B |
7 | 2die:A | 481 | 35 | 0.0611 | 0.0229 | 0.3143 | 2.7 | |
8 | 4ecg:A | 368 | 37 | 0.0611 | 0.0299 | 0.2973 | 3.9 | |
9 | 6k4y:I | 88 | 42 | 0.0778 | 0.1591 | 0.3333 | 4.1 | |
10 | 2c4m:C | 790 | 98 | 0.1333 | 0.0304 | 0.2449 | 6.2 | 2c4m:A, 2c4m:B, 2c4m:D |
11 | 8ufj:B | 444 | 80 | 0.1056 | 0.0428 | 0.2375 | 7.0 | 8tfb:A, 8tfb:B, 8tfb:C, 8tfb:D, 8tfb:L, 8tfb:M, 8tfb:O, 8tfb:P, 8tfb:Q, 8tfb:V, 8tfb:X, 8tfb:Y, 8tfk:A, 8tfk:B, 8tfk:C, 8tfk:D, 8tfk:E, 8tfk:F, 8tfk:G, 8tfk:H, 8tfk:I, 8tfk:J, 8tfk:K, 8tfk:L, 8ufj:A, 8ufj:C |
12 | 1s7g:A | 252 | 60 | 0.1000 | 0.0714 | 0.3000 | 7.1 | 1ma3:A, 1s7g:B, 1s7g:C, 1s7g:D, 1s7g:E, 4twj:A, 1yc2:A, 1yc2:B, 1yc2:C, 1yc2:D, 1yc2:E |
13 | 7oni:H | 380 | 69 | 0.1056 | 0.0500 | 0.2754 | 8.2 | |
14 | 4jrf:A | 479 | 16 | 0.0500 | 0.0188 | 0.5625 | 8.7 | |
15 | 5tth:B | 621 | 104 | 0.1667 | 0.0483 | 0.2885 | 9.1 | 6d14:B, 7exp:B, 4ipe:B, 4iyn:B, 4j0b:B, 5tvu:B, 5tvw:B, 5tvx:B |