PLDFTQYAKNMRKDLSNQDICLEDGALNHSYFLTKKGQYWTPLNQKALQRGIELFGVGNWKEINYDEFSGKANIVELELR
TCMILGINDITEYYGKKISEEEQEEIKKSNIAKGKKENKLKDNIYQKLQQ
The query sequence (length=130) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7f4l:B | 130 | 130 | 1.0000 | 1.0000 | 1.0000 | 2.16e-93 | 7f4m:B, 7f4n:B |
2 | 1vfc:A | 63 | 68 | 0.1769 | 0.3651 | 0.3382 | 0.037 | 3sjm:A, 3sjm:B, 1w0u:A, 1w0u:B |
3 | 1qgn:A | 398 | 35 | 0.1231 | 0.0402 | 0.4571 | 0.97 | 1i41:A, 1i41:C, 1i41:B, 1i41:D, 1i41:E, 1i41:G, 1i41:F, 1i41:H, 1i41:I, 1i41:K, 1i41:J, 1i41:L, 1i43:A, 1i43:C, 1i43:B, 1i43:D, 1i43:E, 1i43:G, 1i43:F, 1i43:H, 1i43:I, 1i43:K, 1i43:J, 1i43:L, 1i48:A, 1i48:C, 1i48:B, 1i48:D, 1i48:E, 1i48:G, 1i48:F, 1i48:H, 1i48:I, 1i48:K, 1i48:J, 1i48:L, 1qgn:C, 1qgn:B, 1qgn:D, 1qgn:E, 1qgn:G, 1qgn:F, 1qgn:H |
4 | 1hqv:A | 178 | 31 | 0.0846 | 0.0618 | 0.3548 | 1.7 | 3aaj:A, 3aaj:B, 3aak:A, 5gqq:C, 5gqq:D, 5jjg:A, 3wxa:A, 3wxa:B, 2zn8:A, 2zn9:A, 2zn9:B, 2zne:A, 2zne:B, 2zrs:A, 2zrs:B, 2zrs:C, 2zrs:D, 2zrs:E, 2zrs:F, 2zrs:G, 2zrs:H, 2zrt:A, 2zrt:B, 2zrt:C, 2zrt:D, 2zrt:E, 2zrt:F, 2zrt:G, 2zrt:H |
5 | 3msd:A | 330 | 58 | 0.1231 | 0.0485 | 0.2759 | 2.3 | 3msd:B, 3msg:A, 3msg:B, 3mua:A, 3mua:B, 3mui:A, 3mui:B |
6 | 8bqa:AAA | 298 | 43 | 0.1231 | 0.0537 | 0.3721 | 5.0 | |
7 | 8ox1:M | 65 | 30 | 0.0846 | 0.1692 | 0.3667 | 5.5 | 1iv6:A, 8ox1:L, 1w0t:A, 1w0t:B |
8 | 6k13:A | 332 | 34 | 0.0923 | 0.0361 | 0.3529 | 5.8 | 6k13:B |
9 | 5xxb:C | 394 | 25 | 0.0769 | 0.0254 | 0.4000 | 6.9 | |
10 | 7c4p:A | 55 | 36 | 0.0769 | 0.1818 | 0.2778 | 7.3 | 7c4p:B, 7c4q:A, 7c4q:B, 7c4r:A, 7c4r:B |
11 | 8uru:F | 51 | 60 | 0.1308 | 0.3333 | 0.2833 | 9.0 | 8urq:F |