PKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSA
TTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCCRAERRVVPLVQMGETDANVAKFLNRLSDYLFT
LARYAAMKEGNQEKIYMKNDPSAESEG
The query sequence (length=187) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7rut:E | 187 | 187 | 1.0000 | 1.0000 | 1.0000 | 1.46e-140 | 6d5k:A, 6d5k:C, 6d5k:B, 6d5x:A, 6d5x:C, 6d5x:B, 2idx:A, 2idx:C, 2idx:B, 7rut:D, 7rut:C, 7rut:F, 7rut:B, 7rut:A, 7ruu:A, 7ruu:C, 7ruu:B, 7ruu:D, 7ruv:A, 7ruv:D, 7ruv:B, 7ruv:C |
2 | 3ci1:A | 188 | 179 | 0.3797 | 0.3777 | 0.3966 | 7.34e-38 | 3ci3:A, 3ci4:A, 3gah:A, 3gai:A, 3gaj:A, 2nt8:A, 2r6t:A, 2r6t:B, 2r6x:A, 2r6x:B |
3 | 3ke5:A | 182 | 167 | 0.3797 | 0.3901 | 0.4251 | 2.59e-33 | 3ke5:C, 3ke5:B |
4 | 2zhz:B | 174 | 176 | 0.3636 | 0.3908 | 0.3864 | 5.03e-32 | 2zhz:A, 2zhz:C |
5 | 8d32:A | 186 | 171 | 0.3316 | 0.3333 | 0.3626 | 2.15e-20 | 6wgs:A, 6wgv:A, 6wh5:A, 6wh5:B, 6wh5:C |
6 | 7rka:A | 211 | 46 | 0.0749 | 0.0664 | 0.3043 | 2.2 | |
7 | 8joz:A | 257 | 58 | 0.1070 | 0.0778 | 0.3448 | 2.4 | 4htf:A, 4htf:B |
8 | 4p0q:B | 284 | 53 | 0.0963 | 0.0634 | 0.3396 | 2.7 | 4p0r:B, 4p0r:D, 4p0s:B, 4p0s:H, 4p0s:F, 4p0s:D |