BioLiP

>protein
PKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQG

The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2li8:A	63	63	1.0000	1.0000	1.0000	1.96e-41
2	2cqf:A	63	53	0.8254	0.8254	0.9811	7.06e-34
3	5udz:A	139	51	0.7302	0.3309	0.9020	1.82e-29	8ops:B, 8opt:B, 8ost:B, 3trz:A, 3trz:B, 3trz:C, 3trz:D, 3trz:E, 3trz:F, 3ts0:A, 3ts0:B, 3ts2:A, 3ts2:B, 5udz:B
4	2ec7:A	49	38	0.2381	0.3061	0.3947	4.45e-04
5	2a51:A	39	37	0.2540	0.4103	0.4324	0.030
6	7s7b:F	352	26	0.1429	0.0256	0.3462	0.093	7s7b:B, 7s7c:B
7	5w0n:A	379	27	0.1429	0.0237	0.3333	0.28	5w0m:A, 5w0m:C, 5w0n:B
8	6rwg:A	157	44	0.2381	0.0955	0.3409	0.38	1a1t:A, 1aaf:A, 1bj6:A, 2buo:A, 1esk:A, 2exf:A, 1f6u:A, 5i1r:A, 2jzw:A, 2l4l:A, 2m3z:A, 1mfs:A, 1q3y:A, 1q3z:A, 7r7p:I, 7r7p:L
9	4v6w:CT	158	22	0.1429	0.0570	0.4091	1.1	6xu6:CT, 6xu7:CT, 6xu8:CT
10	5w0b:A	334	25	0.1429	0.0269	0.3600	1.4
11	3i01:A	673	36	0.1905	0.0178	0.3333	1.5	3i01:B, 3i01:C, 3i01:D, 3i04:A, 3i04:B, 3i04:C, 3i04:D, 1mjg:A, 1mjg:B, 1mjg:C, 1mjg:D, 1oao:A, 1oao:B, 6x5k:A, 6x5k:B, 6x5k:C, 6x5k:D, 2z8y:A, 2z8y:B, 2z8y:C, 2z8y:D
12	3nyb:B	64	15	0.1429	0.1406	0.6000	3.3
13	5jox:A	502	25	0.1905	0.0239	0.4800	3.7	5jox:B, 5joy:A, 5joy:B
14	2bl6:A	37	36	0.2063	0.3514	0.3611	6.7
15	7c4c:A	332	45	0.2381	0.0452	0.3333	8.0	7c42:A, 7c43:A, 7c45:A, 7c47:A, 7c4b:A
16	7c4c:A	332	47	0.2222	0.0422	0.2979	8.4	7c42:A, 7c43:A, 7c45:A, 7c47:A, 7c4b:A
17	2o4u:X	331	14	0.1429	0.0272	0.6429	9.9	2poq:X

[Back]