PHIDIKCFPRELDEQQKAALAADITDVIIRHLNSKDSSISIALQQIQPESWQAIWDAEIAPQMEALIKKPGYSMNA
The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1gyx:B | 76 | 76 | 1.0000 | 1.0000 | 1.0000 | 3.12e-51 | 1gyy:A, 1gyy:B |
2 | 6k3c:B | 351 | 26 | 0.1447 | 0.0313 | 0.4231 | 1.6 | |
3 | 3ip5:A | 348 | 35 | 0.1579 | 0.0345 | 0.3429 | 3.5 | 3ip6:A, 3ip7:A, 3ip9:A, 3ipa:A, 3ipc:A |
4 | 8oku:A | 338 | 48 | 0.1711 | 0.0385 | 0.2708 | 4.1 | 8oku:B, 8r4o:A, 8r4o:C, 8r4o:E, 8r4o:G, 8r4o:I, 8r4o:K, 8r4q:A, 8r4q:C, 8r4q:E, 8r4q:G, 8r4q:I, 8r4q:K, 8r4u:A, 8r4u:C, 8r4u:E, 8r4u:G, 8r4v:A, 8r4v:B, 8r4v:C |
5 | 8r8r:A | 1188 | 33 | 0.1711 | 0.0109 | 0.3939 | 4.4 | |
6 | 4p7m:A | 104 | 38 | 0.1579 | 0.1154 | 0.3158 | 5.2 | 4p7s:A, 4p7s:B, 4p7s:C |
7 | 4pso:I | 221 | 47 | 0.1974 | 0.0679 | 0.3191 | 6.6 | 4pso:A, 4pso:B, 4pso:C, 4pso:D, 4pso:F, 4pso:G, 4pso:H |
8 | 1pz1:A | 333 | 42 | 0.1974 | 0.0450 | 0.3571 | 6.8 | 1pz1:B |
9 | 4am8:D | 349 | 65 | 0.1842 | 0.0401 | 0.2154 | 8.2 | 4a8h:A, 4a8h:B, 4a8p:A, 4a8p:B, 4a8p:C, 4a8p:D, 4a8p:E, 4a8p:F, 4a8t:A, 4am8:A, 4am8:B, 4am8:C, 4am8:E, 4am8:F |