PGSATVLTLGAHMCKWPIGDPSSEGFTFCGRRSSEGPYCVEHARVAYQ
The query sequence (length=48) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ye1:G | 103 | 48 | 1.0000 | 0.4660 | 1.0000 | 2.41e-32 | 7ye2:G, 5yiv:A, 5yiv:B, 5yiv:C, 5yiv:D, 5yiw:A, 5yiw:C, 5yix:B, 5z7i:A, 5z7i:C |
2 | 6nor:A | 349 | 36 | 0.2500 | 0.0344 | 0.3333 | 0.87 | 6nor:B, 6nor:C, 6nor:D, 6nor:E, 6nor:F |
3 | 3b2d:C | 139 | 23 | 0.2083 | 0.0719 | 0.4348 | 1.1 | 3b2d:D |
4 | 6bjq:A | 598 | 29 | 0.1875 | 0.0151 | 0.3103 | 1.3 | 6d4o:A, 8gen:A, 8geo:A, 8geq:A, 8ger:A, 8ugt:A |
5 | 3t6q:C | 139 | 36 | 0.2292 | 0.0791 | 0.3056 | 1.9 | 3m7o:A, 3m7o:D, 3t6q:D |
6 | 3rg1:C | 138 | 23 | 0.1875 | 0.0652 | 0.3913 | 3.7 | 3rg1:O, 3rg1:D, 3rg1:H, 3rg1:L, 3rg1:P |
7 | 3l4u:A | 864 | 47 | 0.2500 | 0.0139 | 0.2553 | 4.8 | 3ctt:A, 3l4t:A, 3l4v:A, 3l4w:A, 3l4x:A, 3l4y:A, 3l4z:A, 2qmj:A |
8 | 3wqy:A | 905 | 29 | 0.1875 | 0.0099 | 0.3103 | 7.3 | 3wqy:B, 3wqz:A, 3wqz:B, 2ztg:A |
9 | 5idj:A | 242 | 24 | 0.2083 | 0.0413 | 0.4167 | 8.0 | 5idm:A, 5idm:B |
10 | 7dmk:A | 732 | 26 | 0.2083 | 0.0137 | 0.3846 | 8.6 | 7dmk:B, 7dmk:C, 7dmk:D |
11 | 5dp2:A | 335 | 19 | 0.1458 | 0.0209 | 0.3684 | 9.5 | |
12 | 4zxa:W | 324 | 30 | 0.2292 | 0.0340 | 0.3667 | 9.6 | 4zxa:X, 4zxa:Y, 4zxa:Z, 4zxc:W, 4zxc:Z |