PEQQAAEWKLLLGQFPAPVVAQIRELATTHQSELPGYFYEQMGTLRQWIVSVFSMSDDDAALQALIAQQKQIGEIHARIK
IPIHLVLRGARHLRERLFVLLRQRPLDPEHKLFGQRLISETVDLAMEIMSRA
The query sequence (length=132) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4uii:A | 132 | 132 | 1.0000 | 1.0000 | 1.0000 | 1.12e-93 | 4uii:B |
2 | 6m9a:C | 157 | 153 | 0.3258 | 0.2739 | 0.2810 | 3.55e-13 | 6i2z:A, 6i2z:B, 6m9a:A, 6m9a:B, 4uiq:A, 4uiq:B |
3 | 4zvb:A | 150 | 146 | 0.3333 | 0.2933 | 0.3014 | 4.13e-13 | 4zva:A, 4zva:B, 4zvb:B, 4zvb:C, 4zvb:D |
4 | 2w31:A | 152 | 87 | 0.1667 | 0.1447 | 0.2529 | 4.92e-04 | 2w31:B |
5 | 1gt0:D | 79 | 35 | 0.0985 | 0.1646 | 0.3714 | 0.38 | 8bx1:E, 8bx2:E, 6ht5:D, 1o4x:B, 6t90:L, 6yov:L |
6 | 6muu:A | 780 | 19 | 0.0909 | 0.0154 | 0.6316 | 0.72 | 6iqw:A, 6mur:A, 6mus:A, 6mut:A, 6o7e:A, 6o7h:A |
7 | 6o75:A | 710 | 19 | 0.0909 | 0.0169 | 0.6316 | 0.73 | 6o74:A, 6o78:A, 6o79:A, 6o7b:A, 6o7d:A |
8 | 8slm:A | 248 | 45 | 0.1136 | 0.0605 | 0.3333 | 0.83 | 8sln:A |
9 | 5lr8:A | 844 | 80 | 0.1515 | 0.0237 | 0.2500 | 2.8 | 5lr8:B, 5lra:A, 5lra:B, 5lrb:B, 5lrb:A |
10 | 8g0u:C | 455 | 45 | 0.0985 | 0.0286 | 0.2889 | 5.4 | |
11 | 7qv3:w | 593 | 65 | 0.1439 | 0.0320 | 0.2923 | 6.3 |