BioLiP

>protein
PEEMRKRTTEMRLMRELMFREERKARRLKKIKSKTYRKIKKKELMKNRELAADNEDHDIARAKERMTLKHKTNSKWAKDM
IKHGMTNDAETREEMEEMLRQGERLKAK

The query sequence (length=108) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6zqg:UN	108	108	1.0000	1.0000	1.0000	1.24e-71
2	7d5t:RQ	339	58	0.3889	0.1239	0.7241	5.25e-19
3	6ke6:RQ	226	39	0.3611	0.1726	1.0000	1.04e-18	7d5s:RQ, 6lqp:RQ, 6lqq:RQ, 6lqr:RQ, 6lqs:RQ, 6lqt:RQ, 6lqu:RQ, 6lqv:RQ
4	7d63:RQ	275	56	0.3981	0.1564	0.7679	1.12e-18
5	6lbr:A	519	58	0.1852	0.0385	0.3448	0.14	6lbr:B
6	4v8m:BS	179	60	0.1852	0.1117	0.3333	0.38	8ova:BS, 8ove:BS, 5t5h:S
7	3th1:A	246	28	0.1019	0.0447	0.3929	0.56	3th1:B, 3th1:C
8	5lhd:C	905	52	0.1574	0.0188	0.3269	5.0	6atk:C, 6atk:A, 6atk:B, 4fyq:A, 4fyr:A, 4fys:A, 4fyt:A, 5lhd:D, 5lhd:A, 5lhd:B, 6u7e:A, 6u7e:B, 6u7f:A, 6u7f:B, 6u7g:A, 6u7g:B, 7vpq:A, 7vpq:C, 7vpq:E
9	3vo2:A	296	62	0.2130	0.0777	0.3710	6.0	3vo1:A, 3vo1:B, 3vo2:B
10	5gwj:A	677	37	0.1389	0.0222	0.4054	6.1	4g0u:A, 4g0u:B, 4g0v:A, 4g0v:B, 4g0w:A, 4g0w:B, 5gwi:A, 5gwi:B, 5gwj:B, 4j3n:A, 4j3n:B, 3qx3:A, 3qx3:B, 5zrf:A, 5zrf:B
11	5e6m:A	519	47	0.1481	0.0308	0.3404	7.9	4kr2:A, 4kr3:A
12	7s1x:B	871	26	0.1019	0.0126	0.4231	8.8	7mxo:A, 7mxo:B, 7n3n:A, 7n3n:B, 7s1x:A, 7s1y:A, 7s1y:B, 7sfl:A, 7sfl:B, 7smp:B, 7smp:A, 8ste:A, 8ste:B, 7zgo:A, 7zgo:B

[Back]