PATVAELQAEIAAWIHPLNPDRRPGGTIAKLLEEIGELIASDRDPLEVADVLILALDLATLLGVDVTEAIRAKLAINRAR
SWARADNGAMRHIPGSDTP
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ody:C | 100 | 98 | 0.9697 | 0.9600 | 0.9796 | 3.35e-61 | 7ody:A, 7ody:B, 7ody:D |
2 | 2q5z:B | 94 | 92 | 0.2626 | 0.2766 | 0.2826 | 0.084 | 2q5z:A, 2q73:A, 2q73:B, 2q73:C, 2q73:D, 2q9l:A, 2q9l:B, 2q9l:C, 2q9l:D |
3 | 6sqw:A | 114 | 34 | 0.1414 | 0.1228 | 0.4118 | 0.26 | 2oig:B, 2oig:A, 2oig:D, 6sqw:D, 6sqy:A, 6sqy:D, 6sqz:A, 6sqz:D |
4 | 7mu5:A | 110 | 34 | 0.1515 | 0.1364 | 0.4412 | 0.62 | 7mu5:E, 7mu5:B, 7mu5:H, 7mu5:C, 7mu5:D, 7mu5:F, 7mu5:G |
5 | 5iit:C | 357 | 62 | 0.2121 | 0.0588 | 0.3387 | 3.0 | 3iid:A, 3iif:A, 3iif:B, 3iif:C, 5iit:B |
6 | 6ax9:A | 340 | 58 | 0.1919 | 0.0559 | 0.3276 | 6.0 | 6axm:A, 6axn:A, 6axu:A, 3kb9:A, 7kj8:A, 7kj9:A, 7kjd:A, 7kje:A, 7kjf:A, 7kjg:A, 3lg5:A, 4ltz:A, 4luu:A, 4lxw:A, 4lz0:A, 4lz3:A, 4lzc:A, 6ofv:A, 8su1:A, 8su2:A, 8su3:A, 8su4:A, 8su5:A, 8v3k:A |
7 | 7xn7:m | 1187 | 17 | 0.0909 | 0.0076 | 0.5294 | 6.4 | 7xse:m, 7xsx:m, 7xsz:m, 7xt7:m, 7xtd:m, 7xti:m |
8 | 6nu8:A | 488 | 43 | 0.1818 | 0.0369 | 0.4186 | 8.5 |