PADHWGIDSINYLVEKGAVFEPGKELTRAEAATMMAQILNLPIDKDAKPSFADSQGQWYTPFIAAVEKAGVIKGTGNGFE
PNGKIDRVSMASLLVEAYKLDTKVNGTPATKFKDLETLNWGKEKANILVELGISVGTGDQWEPKKTVTKAEAAQFIAKTD
KQFGT
The query sequence (length=165) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6bt4:A | 165 | 165 | 1.0000 | 1.0000 | 1.0000 | 8.59e-120 | |
2 | 2v0n:A | 459 | 70 | 0.1030 | 0.0370 | 0.2429 | 1.3 | 2v0n:B, 1w25:A, 1w25:B, 2wb4:A, 2wb4:B |
3 | 7s7j:A | 84 | 59 | 0.0970 | 0.1905 | 0.2712 | 2.0 | |
4 | 1p77:A | 265 | 43 | 0.1030 | 0.0642 | 0.3953 | 5.2 | |
5 | 6cvq:A | 180 | 40 | 0.0788 | 0.0722 | 0.3250 | 5.7 | 6cvo:A, 6cvo:B, 6cvp:A, 6cvp:B, 6cvq:B, 6cvr:A, 6cvr:B, 6cvs:A, 6cvs:B, 6cvt:A, 6cvt:B, 4ndf:A, 4ndf:B, 4ndg:A, 4ndg:B, 4ndh:A, 4ndh:B, 4ndi:A, 4ndi:B |
6 | 6zca:Y | 1127 | 63 | 0.1212 | 0.0177 | 0.3175 | 5.7 | 6zfb:Y, 6zfb:y |
7 | 6wvk:D | 1184 | 63 | 0.1212 | 0.0169 | 0.3175 | 5.8 | 6wvj:D |
8 | 3fwr:B | 146 | 93 | 0.1394 | 0.1575 | 0.2473 | 6.1 | 3fwr:A, 3fws:A, 3fws:B |
9 | 7f75:D | 1142 | 66 | 0.1212 | 0.0175 | 0.3030 | 6.6 | 7ckq:D |
10 | 8s9u:D | 518 | 68 | 0.1152 | 0.0367 | 0.2794 | 8.7 | 8s9t:D, 8s9v:D, 8s9x:D |
11 | 8wfl:A | 552 | 23 | 0.0545 | 0.0163 | 0.3913 | 9.0 | 8wfi:A, 8wfj:A, 8wfk:A, 6zbv:A, 6zpl:B, 6zpl:A |
12 | 4a35:A | 441 | 41 | 0.0848 | 0.0317 | 0.3415 | 9.1 |