NYKPPAQKSIQEIQELDKDDESLRKYKEALLVPNVVVTRLTLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKIS
FRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSRFTDDDRTDHLSWEWN
LTIKKEW
The query sequence (length=167) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1doa:B | 200 | 177 | 1.0000 | 0.8350 | 0.9435 | 1.76e-121 | 4f38:B, 5fr1:B, 5fr2:B, 1hh4:D, 1hh4:E |
2 | 8i01:A | 594 | 34 | 0.0838 | 0.0236 | 0.4118 | 1.6 | 8beo:A, 8beo:B, 8beo:C, 8beo:E, 8beo:D, 8beo:F, 8i01:B, 8i01:C, 8i01:E, 8i01:D, 8i01:F, 8i05:A, 8i05:B, 8i05:C, 8i05:E, 8i05:D, 8i05:F, 8i07:A, 8i07:B, 8i07:C, 8i07:E, 8i07:D, 8i07:F, 8i08:A, 8i08:B, 8i08:C, 8i08:E, 8i08:D, 8i08:F, 2pan:A, 2pan:B, 2pan:C, 2pan:D, 2pan:E, 2pan:F |
3 | 5s5a:E | 123 | 37 | 0.0898 | 0.1220 | 0.4054 | 1.9 | |
4 | 7ouc:AAA | 527 | 66 | 0.1078 | 0.0342 | 0.2727 | 3.1 | 7oud:AAA |