NVTLTAVKKAFPDALTNAELVAMVSKRLSQFGYHKYNTLLATSLCSDEVTRPLEQDFGEVYGKHFTMGGLAGFPFGGLTG
FGAMAGAIPDGGSCLLIYGSHVGVSWEGKWGTVARRGREKGGACCGSAVAAAQAVTQAYQATPLDAQQGYVRDMLRPYAA
TLSEAEDVMVTLPVSVYDAQQKLVTRILDEGSNHIDGDGQIAVVGGIQINTPKEMSDFFVVRRFCIRDSSGNMVENFMPL
The query sequence (length=240) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5b5y:B | 241 | 241 | 0.9958 | 0.9917 | 0.9917 | 2.49e-179 | 5b5y:A, 5b5z:A, 5b5z:B, 5b60:A |
2 | 6kfs:A | 248 | 246 | 0.5250 | 0.5081 | 0.5122 | 7.43e-86 | |
3 | 5k5w:B | 226 | 75 | 0.1083 | 0.1150 | 0.3467 | 7.34e-07 | |
4 | 5b5x:A | 225 | 77 | 0.1042 | 0.1111 | 0.3247 | 4.75e-05 | |
5 | 5k5w:A | 198 | 73 | 0.1000 | 0.1212 | 0.3288 | 1.70e-04 | |
6 | 7xyr:A | 546 | 65 | 0.0708 | 0.0311 | 0.2615 | 1.8 | |
7 | 8wch:A | 396 | 59 | 0.0792 | 0.0480 | 0.3220 | 2.2 | 8wch:B |
8 | 4hg0:A | 232 | 34 | 0.0583 | 0.0603 | 0.4118 | 7.7 | 3nqr:A, 3nqr:B, 3nqr:C, 3nqr:D, 5yz2:A, 5yz2:B |