NVPVTGVTVNPTTAQVEVGQSVQLNASVAPSNATNKQVTWSVSGSSIASVSPNGLVTGLAQGTTTVTATTADGNKAASAT
ITVAPAPSTVIVIGDEVKGLKKIGDDLLFYVNGATFADLHYKVNNGGQLNVAMAPTGNGNYTYPVHNLKHGDTVEYFFTY
NPGQGALDTPWQTYVHGVTQGTPE
The query sequence (length=184) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7r1n:AAA | 184 | 184 | 1.0000 | 1.0000 | 1.0000 | 7.44e-131 | 7r1n:BBB, 7r1n:CCC, 7r1n:DDD |
2 | 5h9y:A | 412 | 61 | 0.1413 | 0.0631 | 0.4262 | 2.21e-04 | |
3 | 8f2m:D | 434 | 77 | 0.1630 | 0.0691 | 0.3896 | 0.004 | |
4 | 8em7:A | 4378 | 81 | 0.1413 | 0.0059 | 0.3210 | 0.14 | 8em7:B, 8jut:A, 8jut:B, 8juu:B, 8juu:A, 8jx8:B, 8jx8:A, 8jx9:B, 8jxa:A, 8jxb:A, 8jxd:A, 8jxe:A, 8jxe:B, 8jxf:B, 8jxg:A, 8jxh:A, 8jxi:B |
5 | 8em4:A | 3818 | 81 | 0.1413 | 0.0068 | 0.3210 | 0.14 | 8em4:B |
6 | 8jxj:A | 570 | 79 | 0.1304 | 0.0421 | 0.3038 | 0.19 | 8jxj:B |
7 | 6i0x:B | 422 | 81 | 0.1250 | 0.0545 | 0.2840 | 0.97 | 5ak7:A, 5ak8:A, 6i0x:A, 4ytb:A, 4ytg:A |
8 | 5vkm:A | 306 | 47 | 0.0815 | 0.0490 | 0.3191 | 2.2 | |
9 | 8d0b:A | 1116 | 58 | 0.1033 | 0.0170 | 0.3276 | 5.7 | 8d0k:A |
10 | 7u5c:E | 1147 | 58 | 0.1033 | 0.0166 | 0.3276 | 5.7 | |
11 | 8soj:A | 1158 | 58 | 0.1033 | 0.0164 | 0.3276 | 5.7 | 8sok:A |
12 | 3cur:H | 545 | 45 | 0.0924 | 0.0312 | 0.3778 | 8.5 | 3cur:I, 3cur:J, 3cus:Q, 3cus:R, 3cus:S, 1frf:L, 3h3x:Q, 3h3x:R, 3h3x:S, 4ucq:Q, 4ucq:R, 4ucq:S, 4ucw:Q, 4ucw:R, 4ucw:S, 4ucx:Q, 4ucx:R, 4ucx:S, 4ud2:S, 4ud2:Q, 4ud2:R, 4ud6:Q, 4ud6:R, 4ud6:S, 4ue2:Q, 4ue2:R, 4ue2:S, 4ue6:R, 4ue6:Q, 4ue6:S, 4ueq:Q, 4ueq:R, 4ueq:S, 4ueq:T, 4ueq:U, 4ueq:V, 4uew:Q, 4uew:R, 4uew:S, 4upe:Q, 4upe:R, 4upe:S, 4upv:Q, 4upv:R, 4uql:Q, 4uql:R, 4uqp:Q, 4uqp:R, 4urh:Q, 4urh:S, 4urh:R, 1yqw:Q, 1yqw:R, 1yqw:S, 1yrq:H, 1yrq:I, 1yrq:J, 1yrq:K, 1yrq:M, 1yrq:N |
13 | 5wab:A | 674 | 93 | 0.1359 | 0.0371 | 0.2688 | 8.6 | |
14 | 2vos:A | 448 | 103 | 0.1576 | 0.0647 | 0.2816 | 8.7 | 2vor:A |