NTRNFSLPQLQNLPIEEARIVADALAVHATSRQIDSAASKLAALAEAGLKGDRQAYAAYQQLLYVLSLSDDVATAQTRRW
LARAIYRVEERFMPAADLSRALSEEDFQKRLEQEIAAQSRERHPMSQYVFSGSASRAQLQVFLRHQWFRTFRLYRDAADL
LVNLTDVDEAAALARYLYGELGEEDEKGSHPRLLAKLLEAIGLEADFQAVSTMPEEIAYLNNRARAFRHAEVGWGLAVFY
ITELVVPGNHEKLYRALLQAGLSEDQAEYYKVHISLVPPRAKREWQLIARRIPDVQFQNAFLTSLSQHFRVERAYYDAIW
EEMQSV
The query sequence (length=326) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 9b9m:B | 329 | 326 | 0.9969 | 0.9878 | 0.9969 | 0.0 | 9b9m:A, 9b9m:C, 9b9m:D, 9b9n:A, 9b9n:B, 9b9o:A, 9b9o:B, 8w1q:A, 8w1q:B |
2 | 8u8l:B | 123 | 51 | 0.0491 | 0.1301 | 0.3137 | 0.92 | 8u8l:A |
3 | 7dbl:A | 422 | 85 | 0.0706 | 0.0545 | 0.2706 | 1.3 | 7dbl:B, 7dbl:C, 7dbl:D |
4 | 4cej:B | 1156 | 85 | 0.0736 | 0.0208 | 0.2824 | 3.1 | 4ceh:B, 4cei:B, 3u44:B, 3u4q:B |
5 | 4u08:A | 391 | 47 | 0.0399 | 0.0332 | 0.2766 | 7.7 | 4u08:B |
6 | 1otw:A | 255 | 85 | 0.0706 | 0.0902 | 0.2706 | 9.6 | 3hlx:A, 3hlx:D, 3hml:A, 3hml:B, 3hnh:A, 4ny7:A, 4ny7:B, 1otw:B |