BioLiP

>protein
NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSAHVVKAKRQGQSMIYSLDDIHVA
TMLKQAIHHANHP

The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6cdb:A	97	93	0.9785	0.9381	0.9785	6.85e-63	6cda:A, 6cdb:B, 4ggg:A, 4ggg:B, 2m30:A, 2m30:B, 1r1v:A
2	1r23:A	104	88	0.3226	0.2885	0.3409	1.22e-09	1r22:A, 1r22:B, 1r23:B
3	6o8m:A	95	74	0.2688	0.2632	0.3378	1.94e-08
4	1u2w:B	107	83	0.3011	0.2617	0.3373	2.64e-08	1u2w:A, 1u2w:C
5	2jsc:B	97	81	0.2688	0.2577	0.3086	3.99e-08	2jsc:A
6	4omy:A	97	63	0.2043	0.1959	0.3016	5.71e-05	4omy:B, 4omy:C, 4omy:D, 4on0:A, 4on0:B, 4on0:C, 4on0:D
7	5lqw:F	218	83	0.2151	0.0917	0.2410	0.48
8	7dco:R	261	67	0.1935	0.0690	0.2687	0.60	7b9v:M, 6bk8:G, 6exn:M, 5gm6:R, 5gmk:R, 6j6g:R, 6j6h:R, 6j6n:R, 6j6q:R, 5lj3:M, 5lj5:M, 5mps:M, 5mq0:M, 3tp2:A, 3tp2:B, 3u1l:A, 3u1m:A, 5wsg:R, 5y88:N, 5ylz:N
9	4kdp:A	151	43	0.1290	0.0795	0.2791	1.2	4ejv:A, 4ejv:B, 4ejw:A, 4ejw:B, 4kdp:B, 4kdp:C, 4kdp:D, 3kp2:A, 3kp2:B, 3kp3:B, 3kp4:A, 3kp4:B, 3kp5:A, 3kp5:B
10	4aso:A	93	43	0.1290	0.1290	0.2791	2.1	4aso:B, 4aso:D, 4aso:E, 4aso:F, 4aso:G, 4aso:H, 4aso:I, 4aso:K, 4aso:J, 4aso:L, 4aso:M, 4aso:N, 4aso:O, 4aso:P, 4ass:E, 4ass:F, 4ass:G, 4ass:H
11	6vu9:A	631	33	0.1398	0.0206	0.3939	2.4
12	3e78:A	365	83	0.1935	0.0493	0.2169	8.0	3e79:A, 3eki:A
13	8y6u:H	92	81	0.2366	0.2391	0.2716	9.8	8y6u:J

[Back]