NSVIETILNHRSIRKYEDKPLSEEQIQTIVESAQAASTSSYIQAYSIIGVKDKETKRKLAQLAGNQPYVETNGHFFVFCA
DFHRHDVIAEMEKKDLSTALESTEQFMVAIIDVALAAQNATLAAESMGLGACYIGGLRNELEEVSKLLKLPHHVIPLFGL
TVGHPAGITDKKPRLPFKHVYHEETYEPNDEQTKKELTAYNEEISAYYNERTNGKRQDTWTGQMAEMLSNPKRMYMKEFV
EKQGFNK
The query sequence (length=247) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5hdj:B | 248 | 247 | 1.0000 | 0.9960 | 1.0000 | 0.0 | 5hdj:A |
2 | 3n2s:A | 248 | 247 | 0.5951 | 0.5927 | 0.5951 | 8.36e-113 | 3n2s:B, 3n2s:C, 3n2s:D |
3 | 8ajx:A | 240 | 242 | 0.4372 | 0.4500 | 0.4463 | 1.00e-67 | 1f5v:A, 1f5v:B, 7nb9:A, 7niy:A, 7nmp:A, 7nnx:A, 7q0o:A, 7z0w:A, 7z0w:B, 7z0w:C, 7z0w:D, 7z0w:E, 7z0w:F, 7z0w:G, 7z0w:H |
4 | 1zch:A | 249 | 248 | 0.4251 | 0.4217 | 0.4234 | 7.99e-66 | |
5 | 5uu6:C | 236 | 247 | 0.4049 | 0.4237 | 0.4049 | 7.12e-63 | 5uu6:A, 5uu6:B, 5uu6:D |
6 | 1bkj:A | 230 | 247 | 0.4089 | 0.4391 | 0.4089 | 3.48e-61 | 1bkj:B, 2bkj:A, 2bkj:B |
7 | 5hei:A | 246 | 245 | 0.4008 | 0.4024 | 0.4041 | 3.26e-58 | 5hei:B, 5hei:C, 5hei:D, 5hei:E, 5hei:F, 5hei:G, 5hei:H |
8 | 3eof:A | 248 | 202 | 0.2591 | 0.2581 | 0.3168 | 5.75e-30 | 3eof:B |
9 | 3m5k:A | 168 | 184 | 0.2227 | 0.3274 | 0.2989 | 3.63e-21 | 3m5k:B |
10 | 4dn2:A | 191 | 189 | 0.2024 | 0.2618 | 0.2646 | 2.76e-14 | 4dn2:B |
11 | 3kwk:A | 168 | 179 | 0.1862 | 0.2738 | 0.2570 | 4.41e-14 | |
12 | 4g8s:A | 182 | 176 | 0.1943 | 0.2637 | 0.2727 | 1.07e-12 | 4g8s:B |
13 | 3ge5:A | 176 | 179 | 0.1660 | 0.2330 | 0.2291 | 1.99e-12 | 3ge5:B |
14 | 8uc3:A | 180 | 162 | 0.1943 | 0.2667 | 0.2963 | 5.89e-12 | 8uc3:B |
15 | 8cqt:B | 164 | 172 | 0.1822 | 0.2744 | 0.2616 | 4.34e-10 | 8cqt:A |
16 | 1nox:A | 200 | 86 | 0.1174 | 0.1450 | 0.3372 | 1.07e-08 | |
17 | 5j6c:A | 173 | 132 | 0.1700 | 0.2428 | 0.3182 | 1.46e-08 | 5j6c:B |
18 | 3gfa:A | 197 | 194 | 0.1862 | 0.2335 | 0.2371 | 2.53e-08 | 3gfa:B |
19 | 5j62:B | 209 | 146 | 0.1619 | 0.1914 | 0.2740 | 3.40e-08 | 5j62:A |
20 | 3e10:B | 167 | 170 | 0.1700 | 0.2515 | 0.2471 | 1.26e-07 | 3e10:A |
21 | 3ek3:A | 187 | 150 | 0.1457 | 0.1925 | 0.2400 | 5.38e-07 | |
22 | 3gag:A | 206 | 172 | 0.1579 | 0.1893 | 0.2267 | 8.12e-06 | 3gag:B, 3gag:C, 3gag:D |
23 | 3e39:A | 175 | 189 | 0.1822 | 0.2571 | 0.2381 | 8.64e-05 | 3e39:B |
24 | 3gr3:A | 226 | 197 | 0.1619 | 0.1770 | 0.2030 | 1.60e-04 | 3gr3:B |
25 | 2isj:A | 219 | 206 | 0.1862 | 0.2100 | 0.2233 | 2.50e-04 | 2isj:B, 2isj:C, 2isj:D, 2isj:E, 2isj:F, 2isj:G, 2isj:H, 2isk:A, 2isk:B, 2isk:C, 2isk:D, 2isk:E, 2isk:F, 2isk:G, 2isk:H, 2isl:A, 2isl:B, 2isl:C, 2isl:D, 2isl:E, 2isl:F, 2isl:G, 2isl:H |
26 | 3eo8:A | 219 | 172 | 0.1336 | 0.1507 | 0.1919 | 3.68e-04 | 3eo8:B, 3eo8:C, 3eo8:D, 3eo8:E, 3eo8:F |
27 | 3koq:A | 173 | 181 | 0.1538 | 0.2197 | 0.2099 | 5.46e-04 | 3h4o:A, 3koq:B, 3koq:C, 3koq:D |
28 | 3pxv:B | 189 | 199 | 0.2308 | 0.3016 | 0.2864 | 0.001 | 3pxv:A, 3pxv:C, 3pxv:D |
29 | 4xoq:A | 204 | 66 | 0.0850 | 0.1029 | 0.3182 | 0.036 | 4xoo:A, 4xoo:B, 4xoo:C, 4xoo:D, 4xoq:B, 4xoq:C, 4xoq:D |
30 | 5hxd:A | 237 | 105 | 0.1215 | 0.1266 | 0.2857 | 0.12 | 5hxd:B |
31 | 4ttc:A | 220 | 76 | 0.0729 | 0.0818 | 0.2368 | 0.23 | 4ttc:B, 4ttc:C, 4ttc:D, 4ttc:E, 4ttc:F, 5yak:A, 5yak:F, 5yak:B, 5yak:C, 5yak:D, 5yak:E |
32 | 7dp0:A | 223 | 44 | 0.0526 | 0.0583 | 0.2955 | 0.34 | 7dp0:B, 7dp1:A, 7dp1:B, 7dp2:A, 7dp2:B |
33 | 4ttb:A | 189 | 55 | 0.0526 | 0.0688 | 0.2364 | 0.57 | 4ttb:B |
34 | 3tnz:A | 222 | 55 | 0.0526 | 0.0586 | 0.2364 | 1.4 | 3gfd:A, 3gfd:B, 3gh8:A, 3gh8:B, 3gh8:C, 3gh8:D, 3gh8:E, 3gh8:F, 3gh8:G, 3gh8:H, 3tnz:B |
35 | 8fkp:NS | 305 | 57 | 0.0810 | 0.0656 | 0.3509 | 1.8 | 8fkr:NS, 8fkt:NS, 8fkv:NS |
36 | 3gb5:A | 185 | 46 | 0.0445 | 0.0595 | 0.2391 | 4.4 | 3to0:A, 3to0:B |
37 | 4f0c:A | 228 | 89 | 0.1053 | 0.1140 | 0.2921 | 4.4 | 5o00:A |
38 | 2r01:A | 195 | 67 | 0.0769 | 0.0974 | 0.2836 | 6.0 | |
39 | 1m0u:A | 203 | 34 | 0.0486 | 0.0591 | 0.3529 | 7.0 | |
40 | 6s2e:A | 1006 | 96 | 0.1012 | 0.0249 | 0.2604 | 7.2 | 6s2f:A |
41 | 8wbu:A | 391 | 73 | 0.0810 | 0.0512 | 0.2740 | 9.1 | 7d5g:A, 8wbv:A |
42 | 8w1o:K | 1290 | 34 | 0.0526 | 0.0101 | 0.3824 | 9.4 | |
43 | 6g0a:A | 1104 | 81 | 0.0891 | 0.0199 | 0.2716 | 9.5 | 8b67:A, 6fwk:B, 6i8a:B, 7r3y:B |
44 | 4m8o:A | 1126 | 81 | 0.0891 | 0.0195 | 0.2716 | 9.7 | 8b6k:A, 8b6k:B, 8b76:B, 8b76:A, 8b77:A, 8b79:B, 8b79:A, 8b7e:B, 8b7e:A, 6fwk:A, 6h1v:A, 6i8a:A, 5oki:B, 4ptf:A, 6qib:A, 7r3x:A, 7r3y:A, 8tw9:E, 8twa:E |