BioLiP

>protein
NSSAEVSVESPSFSFNCAHFIAYNGFRETLHGHNYNVSLKVRGYVRDDGYVIDFSILKEKVKKVCNKLDHHFILPIYSDV
LKFENVKNNIKIICEDNSEYSFPERDCIKLPIKHSSTEEIGQYILNQLIEEMDVSLLKSRHIHYIEISVSESPTQKAIVH
KYI

The query sequence (length=163) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1y13:A	163	163	1.0000	1.0000	1.0000	4.38e-118	1y13:C, 1y13:B
2	2a0s:A	163	160	0.7178	0.7178	0.7312	7.90e-89	2a0s:B, 3lx3:A, 3lze:A, 3m0n:A
3	4ntk:A	121	82	0.1656	0.2231	0.3293	3.57e-07	4ntk:E, 4ntk:B, 4ntk:C, 4ntk:D, 4ntk:F, 4ntm:A, 4ntm:E, 4ntm:B, 4ntm:C, 4ntm:D, 4ntm:F, 4ntn:A, 4ntn:B, 4ntn:C, 4ntn:D, 4ntn:E, 4ntn:F, 3qn0:A, 3qn0:B, 3qn0:C, 3qn0:D, 3qn0:E, 3qn0:F, 3qn9:A, 3qn9:B, 3qna:A, 3qna:B, 3qna:C, 3qna:D, 3qna:E, 3qna:F
4	2dtt:B	115	57	0.1166	0.1652	0.3333	5.72e-06	2dtt:A, 2dtt:C, 2dtt:D, 2dtt:F, 2dtt:E
5	2oba:B	121	77	0.1411	0.1901	0.2987	0.001	2oba:A, 2oba:C, 2oba:D, 2oba:E, 2oba:F
6	7v0f:A	182	62	0.1166	0.1044	0.3065	0.015	7v0f:B
7	2g64:A	140	41	0.1043	0.1214	0.4146	0.041
8	1b66:A	138	78	0.1350	0.1594	0.2821	0.31	1b66:B, 1b6z:A, 1b6z:B, 1gtq:A, 1gtq:B
9	6v0q:A	119	62	0.1104	0.1513	0.2903	1.5	5mq1:A, 6v0q:B, 6v0q:C, 6v0q:D, 6v16:A, 6v16:B, 6v17:A, 6v17:B, 6v1e:A, 6v1f:A, 6v1h:A
10	8oki:A	901	57	0.0920	0.0166	0.2632	4.2	8cro:A, 8orq:A, 8p2i:A, 8rbo:A
11	3jyg:A	180	56	0.1043	0.0944	0.3036	4.9	3jyg:B, 3jyg:C, 3jyg:D, 3jyg:E, 3jyg:F
12	5fog:D	284	61	0.0982	0.0563	0.2623	7.0	5fog:A, 5fog:B, 5fog:C, 5fol:A, 5fom:A
13	1r9d:A	786	67	0.1227	0.0254	0.2985	8.8	1r9d:B

[Back]