NSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSHDGICEIHVAKYAEIFGLTSAEASKDIRQALKSFAGKEVVFYYE
The query sequence (length=214) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
8aan:A |
228 |
215 |
1.0000 |
0.9386 |
0.9953 |
1.62e-160 |
8ac8:A, 8ac8:C, 8d86:C, 8d8m:C, 1rep:C, 7rva:C, 7sdp:C, 7sgc:C, 7soz:C, 7spm:C, 8tip:C, 8tiq:C, 8tir:C, 8tis:C, 8tit:C, 8tiu:C, 8tiv:C, 8tiw:C, 8tix:C, 8tiy:C, 8tiz:C, 8tj0:C, 8tj1:C, 7u6k:C, 7u7o:C, 7ufx:C, 7uog:C, 7ur0:C, 7uv6:C, 7uv7:C, 7uxy:C, 2z9o:A, 2z9o:B |
2 |
4i3b:A |
139 |
48 |
0.0561 |
0.0863 |
0.2500 |
0.39 |
4i3b:B, 4i3b:C, 4i3b:D, 4i3b:E, 4i3b:F, 4i3c:A, 4i3c:B, 4i3d:A, 4i3d:B, 4i3d:C, 4i3d:D |
3 |
1e6z:B |
498 |
42 |
0.0794 |
0.0341 |
0.4048 |
0.97 |
7c34:A, 7c34:B, 7c92:A, 7c92:B, 7cb1:A, 7cb1:B, 1e6r:A, 1e6r:B, 1e6z:A, 1h0g:B, 1h0g:A, 1h0i:A, 1h0i:B, 6jk9:A, 6jk9:B, 6jkf:A, 6jkf:B, 1o6i:A, 1o6i:B, 1ogg:A, 1ogg:B, 1ur8:A, 1ur8:B, 1ur9:A, 1ur9:B, 1w1p:A, 1w1p:B, 1w1t:A, 1w1t:B, 1w1v:A, 1w1v:B, 1w1y:A, 1w1y:B, 3wd1:A, 3wd2:A, 3wd3:A, 3wd4:A, 4z2g:A, 4z2h:A, 4z2i:A, 4z2j:A, 4z2k:A, 4z2l:A |
4 |
7u1x:A |
439 |
114 |
0.1495 |
0.0729 |
0.2807 |
3.4 |
7t7k:B, 7t7k:A, 7t7o:B, 7t7o:A, 7u1v:A, 7u1v:B, 7u1x:B, 7u1y:A |
5 |
7ubz:D |
202 |
53 |
0.0748 |
0.0792 |
0.3019 |
4.2 |
7ubz:B |
6 |
8i9z:CE |
465 |
71 |
0.0841 |
0.0387 |
0.2535 |
6.1 |
8i9p:CE, 8i9r:CE, 8i9t:CE, 8i9v:CE, 8i9w:CE, 8i9x:CE, 8i9y:CE, 8ia0:CE |
7 |
8tdi:G |
386 |
64 |
0.0888 |
0.0492 |
0.2969 |
6.9 |
8tdi:L, 8tdi:J, 8tdi:A, 8tdi:C, 8tdi:D, 8tdi:E, 8tdi:F, 8tdi:H, 8tdi:I, 8tdi:B, 8tdi:K |
8 |
9cys:A |
277 |
53 |
0.0748 |
0.0578 |
0.3019 |
7.0 |
|
9 |
3i6e:A |
356 |
44 |
0.0701 |
0.0421 |
0.3409 |
9.9 |
3i6e:B, 3i6e:C, 3i6e:D, 3i6e:E, 3i6e:F, 3i6e:G, 3i6e:H |