NRSLLGYPLRRAAAMEMLYGGICIQHLAQPPFPLRKIQSESLPPPSLQGERDDLELEVKDSTGNVMGYRLFPVNIGIRAR
TESVRVRSEDCYKRFLAQKHCAAAGVPLQFPAPSSITNSNCLATPRAASHFHPPSSSLSLFTRPADSQGGDVGRTTPADV
AAYHPRAWRPYQMLKPMPHNWGPAVRSSGVRGPHMQLLQERI
The query sequence (length=202) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6hiv:BP | 202 | 202 | 1.0000 | 1.0000 | 1.0000 | 4.04e-151 | 6hix:BP |
2 | 7aih:Aq | 258 | 243 | 0.4554 | 0.3566 | 0.3786 | 4.48e-44 | 7ane:Aq |
3 | 1v9p:A | 584 | 82 | 0.1188 | 0.0411 | 0.2927 | 0.33 | 1dgs:A, 1dgs:B, 1v9p:B |
4 | 5x7m:A | 443 | 51 | 0.0743 | 0.0339 | 0.2941 | 3.4 | 5x7m:B, 5x7n:A, 5x7n:B |
5 | 4v1z:A | 440 | 28 | 0.0594 | 0.0273 | 0.4286 | 7.7 | 4v20:A |
6 | 3ut0:A | 804 | 53 | 0.1040 | 0.0261 | 0.3962 | 8.1 | 3rrx:A, 3usz:A, 3ut0:B, 3ut0:C, 3ut0:D |