BioLiP

>protein
NRPERIQEAIAQDKTSVIIDPSQIGSTEGKPLLSMKCNLYIHEILSRWKASLEAYHPELFLDTKKALFPLLLQLRRNQLA
PDLLISLATVLYHLQQPKEINLAVQSYMKLSIGNVAWPIGVTSVGIHARSAHSKIQGGRNAANIMIDERTRLWITSIKRL
ITFEEWYTSNH

The query sequence (length=171) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6exn:a	171	171	1.0000	1.0000	1.0000	1.34e-126	6bk8:N
2	3acw:A	284	57	0.0877	0.0528	0.2632	0.57	3acx:A, 3acy:A, 3adz:A, 3ae0:A, 3ae0:B, 4e9u:A, 4e9z:A, 4ea0:A, 4ea0:B, 4ea1:A, 4ea2:A, 4f6v:A, 4f6x:A, 3lgz:B, 3npr:A, 3nri:A, 3tfn:A, 3tfp:A, 3tfv:A, 3vje:A, 3vje:B, 3w7f:A, 3w7f:B, 2zcq:A, 2zcr:A, 2zcs:A, 2zy1:A
3	1kqf:A	982	96	0.1520	0.0265	0.2708	2.0	1kqg:A
4	3c6g:B	467	76	0.1462	0.0535	0.3289	2.5	3c6g:A, 3czh:A, 3czh:B, 3dl9:A, 3dl9:B
5	7tbj:A2	1269	86	0.1462	0.0197	0.2907	3.1	7tbj:A4, 7tbk:A2, 7tbk:A4, 7tbl:A2, 7tbl:A4, 7tbm:A2, 7tbm:A4
6	7xuh:A	707	76	0.1462	0.0354	0.3289	3.5	7xuh:B, 7xuj:A, 7xuj:B, 7xul:A, 7xul:B
7	1b8g:B	425	79	0.1228	0.0494	0.2658	6.9	1b8g:A, 1m4n:A, 1m7y:A, 3piu:A, 1ynu:A
8	5ve5:A	350	35	0.0702	0.0343	0.3429	7.2	5ve3:B, 5ve3:A, 5ve4:A, 5ve4:B, 5ve4:C, 5ve5:B, 5ve5:C
9	6wou:A	3921	33	0.0702	0.0031	0.3636	7.4	6wou:B, 6wou:C, 6wou:D, 6wov:A, 6wov:B, 6wov:C, 6wov:D
10	5dzy:B	415	46	0.0994	0.0410	0.3696	8.4	5dzx:A, 5dzx:B, 5dzy:D, 5dzy:A, 5dzy:C, 5dzy:E, 5dzy:F
11	1tlq:A	161	68	0.1287	0.1366	0.3235	9.8

[Back]