NRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRDIDYQKL
HDAFFKWQTKPKLTIHGDLYYEGKEFEGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPP
LYGDVFGTNAAEIDRTPWGELE
The query sequence (length=182) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7vpx:2 | 187 | 187 | 1.0000 | 0.9733 | 0.9733 | 1.00e-132 | 7evo:2, 8hk1:2, 7onb:I, 7q4o:B, 7q4p:B, 6y50:8 |
2 | 8i0r:2 | 250 | 246 | 0.9780 | 0.7120 | 0.7236 | 1.87e-115 | 8ch6:E, 6ff4:8, 6ff7:8, 8i0p:2, 8i0s:2, 8i0t:2, 8i0u:2, 8i0v:2, 8qo9:B2, 7qtt:E, 6qx9:B2, 8qxd:B2, 8r08:B2, 8r0a:B2, 8r0b:B2 |
3 | 7dvq:2 | 216 | 232 | 0.9121 | 0.7685 | 0.7155 | 1.21e-103 | 7abh:T, 7abi:T, 8y7e:2, 5z56:2, 5z57:2, 5z58:2 |
4 | 7q3l:B | 110 | 106 | 0.5220 | 0.8636 | 0.8962 | 7.46e-62 | |
5 | 7q3l:B | 110 | 27 | 0.0659 | 0.1091 | 0.4444 | 0.35 | |
6 | 7dco:2 | 220 | 211 | 0.4231 | 0.3500 | 0.3649 | 1.03e-33 | 6g90:Q, 5gm6:H, 5nrl:Q, 5zwm:2 |
7 | 2zof:A | 478 | 69 | 0.0934 | 0.0356 | 0.2464 | 0.058 | 4ruh:A, 4ruh:B, 2zof:B, 2zog:A, 2zog:B |
8 | 5en7:A | 177 | 39 | 0.0714 | 0.0734 | 0.3333 | 1.8 | 5en6:A, 5en7:C, 5en7:E, 5en7:G |
9 | 2a4x:A | 131 | 48 | 0.0879 | 0.1221 | 0.3333 | 3.8 | 2a4w:A, 2a4w:B, 1kll:A |
10 | 6dbb:A | 504 | 75 | 0.1264 | 0.0456 | 0.3067 | 6.3 | 6dbb:B, 6dbb:C |
11 | 1gxu:A | 88 | 29 | 0.0549 | 0.1136 | 0.3448 | 7.1 |