NRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDR
MARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
The query sequence (length=154) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3fhz:D | 166 | 154 | 1.0000 | 0.9277 | 1.0000 | 1.69e-105 | 3cag:A, 3cag:C, 3cag:E, 3cag:B, 3cag:D, 3cag:F, 3ere:D, 3fhz:C, 3fhz:E, 3fhz:B, 3fhz:F, 3fhz:A, 3laj:C, 3laj:E, 3laj:B, 3laj:F, 3laj:A, 3laj:D, 3lap:C, 3lap:E, 3lap:B, 3lap:F, 3lap:A, 3lap:D, 2zfz:A, 2zfz:C, 2zfz:F, 2zfz:B, 2zfz:D, 2zfz:E |
2 | 6wjp:A | 80 | 79 | 0.2792 | 0.5375 | 0.5443 | 2.02e-25 | 5jvo:A, 5jvo:B, 6wjo:A, 6wjo:B, 6wjp:B |
3 | 1b4b:A | 71 | 64 | 0.1623 | 0.3521 | 0.3906 | 6.75e-12 | 1b4b:C, 1b4b:B |
4 | 2p5l:D | 64 | 58 | 0.1494 | 0.3594 | 0.3966 | 6.26e-10 | 2p5l:C, 2p5l:G, 2p5l:H |
5 | 2p5m:A | 82 | 61 | 0.1429 | 0.2683 | 0.3607 | 1.96e-09 | 2p5m:B, 2p5m:C |
6 | 1xxa:C | 73 | 68 | 0.1494 | 0.3151 | 0.3382 | 3.05e-04 | 1xxa:A, 1xxa:B, 1xxa:D, 1xxa:F, 1xxa:E, 1xxb:A, 1xxb:C, 1xxb:B, 1xxb:D, 1xxb:E, 1xxb:F |
7 | 5ilg:A | 265 | 70 | 0.1299 | 0.0755 | 0.2857 | 1.4 | 5ilg:B, 5ilo:A, 5ilo:B |
8 | 4f66:A | 478 | 53 | 0.1169 | 0.0377 | 0.3396 | 3.2 | 4f66:B, 4f79:A, 4gpn:A, 4gpn:B |
9 | 2qb5:A | 338 | 43 | 0.1039 | 0.0473 | 0.3721 | 4.9 | 2q7d:A, 2q7d:B, 2qb5:B |
10 | 8i3a:A | 562 | 59 | 0.1234 | 0.0338 | 0.3220 | 5.2 | 8i39:A, 8i39:B, 8i3a:B, 8i3b:A, 8i3b:B, 8i3c:A, 8i3c:B, 8iwn:A, 8iwn:C, 8wam:A, 8wam:B, 8wba:A, 8wba:B |
11 | 7yff:B | 740 | 56 | 0.0909 | 0.0189 | 0.2500 | 5.2 | 7yff:D |
12 | 8wbx:B | 467 | 59 | 0.1234 | 0.0407 | 0.3220 | 6.1 | |
13 | 2pve:A | 52 | 21 | 0.0714 | 0.2115 | 0.5238 | 7.1 | 2pve:B, 2pve:C |
14 | 2d6f:D | 522 | 81 | 0.1688 | 0.0498 | 0.3210 | 7.9 | 2d6f:C |
15 | 7vqo:A | 1180 | 23 | 0.0649 | 0.0085 | 0.4348 | 9.6 | 7vqo:B, 7vqo:C, 7vqo:D |
16 | 4d9n:A | 391 | 91 | 0.1494 | 0.0588 | 0.2527 | 9.6 | 4d9m:A, 4d9m:B, 4d9n:B |
17 | 6zxg:j | 116 | 34 | 0.0779 | 0.1034 | 0.3529 | 9.8 | 6zxf:j, 6zxh:j |