BioLiP

>protein
NPWTEYMAKYDIEEVHGSGIRVDLGEDAEVGTQYRLPSGKCPVFGKGIIIETTFLKPVAKDGGFAFPPTNPLISPMTLNG
MRDFYKNNEYVKNLDELTLCSRHAGNMNPDNKNSNYKYPAVYDYNDKKCHILYIAAQENNGFCFRPAKDKLFENYTYLSK
NVVDNWEEVCPRKNLENAKFGLWVDGNCEDIPHVNEFSANDLFECNKLVFELSASDQPKDRYKSHGKGYNWGNYNRETQK
CEIFNVKPTCLINNSSYIATTALSHPIEVE

The query sequence (length=270) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6n87:A	314	314	0.9926	0.8535	0.8535	0.0
2	6n7q:A	266	273	0.9741	0.9887	0.9634	0.0
3	3srj:A	298	289	0.9185	0.8322	0.8581	1.07e-175	3sri:A, 3srj:B, 4z09:A, 4z0d:A, 4z0e:A, 4z0f:A
4	4apm:A	339	277	0.3778	0.3009	0.3682	6.41e-50
5	4yiv:A	374	311	0.3481	0.2513	0.3023	3.30e-30
6	6u9w:A	562	60	0.0741	0.0356	0.3333	0.73	8tr5:A, 8tr5:B, 8tr5:C, 8trj:A, 8trj:C, 8trj:B, 6u9v:A, 6u9v:B, 6u9v:C, 6u9w:B, 6u9w:C, 8v4s:A, 8v4s:B, 8v4s:C
7	1kl7:A	509	45	0.0593	0.0314	0.3556	1.5	1kl7:B
8	3cei:A	213	18	0.0407	0.0516	0.6111	1.5	3cei:B
9	6gio:C	436	59	0.0519	0.0321	0.2373	2.2	6gio:D, 6gio:A, 6gio:B
10	5ldr:A	731	58	0.0519	0.0192	0.2414	3.5	5ldr:B
11	1lf9:A	674	96	0.0852	0.0341	0.2396	4.0	1lf9:B
12	4l63:A	249	47	0.0556	0.0602	0.3191	4.9	4l6t:A
13	4m0x:A	369	41	0.0556	0.0407	0.3659	7.9	4m0x:B
14	7bvs:A	290	37	0.0370	0.0345	0.2703	9.1	7exb:A

[Back]