NPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFE
PPWTLARLSEKARRLLGW
The query sequence (length=98) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3cq3:A | 98 | 98 | 1.0000 | 1.0000 | 1.0000 | 1.72e-66 | 3cq3:B, 3cq3:C, 3cq3:D, 3cq3:E |
2 | 3jb9:B | 904 | 44 | 0.1633 | 0.0177 | 0.3636 | 1.7 | |
3 | 5zdb:A | 253 | 40 | 0.1837 | 0.0711 | 0.4500 | 3.4 | 5zdb:B, 5zdc:C, 5zdc:F, 5zdc:H, 5zdc:J, 5zdc:L, 5zdc:D, 5zdd:A, 5zde:C, 5zdf:A, 5zdg:C |
4 | 7uvx:W | 78 | 24 | 0.1020 | 0.1282 | 0.4167 | 5.8 | 7m4v:W, 7m4w:W, 7m4x:W, 7m4y:W, 7m4z:W, 7ryf:W, 7ryg:W, 7ryh:W, 7uvv:W, 7uvw:W, 7uvy:W, 7uvz:W, 7uw1:W, 6v39:W, 6v3a:W, 6v3b:W, 6v3d:W, 6yhs:T, 6ysi:T |
5 | 4x1t:A | 321 | 19 | 0.1122 | 0.0343 | 0.5789 | 6.7 | |
6 | 8fne:A | 525 | 36 | 0.1531 | 0.0286 | 0.4167 | 7.0 | 8fne:B, 8fne:C, 8fne:D, 8fv5:A, 8fv5:B, 8fv5:C, 8fv5:D, 8fv5:I, 8fv5:J, 8fv5:K, 8fv5:L, 8fv5:M, 8fv5:N, 8fv5:O, 8fv5:P, 8fv5:Q, 8fv5:R, 8fv5:S, 8fv5:T |