NPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRRNSFRLEKILVSVGC
TCVTPIVH
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8uss:A | 107 | 88 | 0.9659 | 0.7944 | 0.9659 | 8.66e-60 | |
2 | 5vb9:A | 108 | 90 | 0.9318 | 0.7593 | 0.9111 | 1.23e-55 | 7ama:A, 7ama:B, 7amg:A, 7amg:B, 7amg:C, 7amg:D, 8cdg:A, 8cdg:B, 8dyf:A, 8dyf:B, 8dyg:A, 8dyg:B, 8dyh:A, 8dyh:B, 8dyi:A, 8dyi:B, 5hhv:A, 5hhx:A, 5hi3:A, 5hi3:B, 5hi4:A, 5hi4:B, 5hi5:A, 5hi5:B, 8usr:A, 8usr:B, 8usr:D, 5vb9:B |
3 | 3jvf:B | 104 | 88 | 0.6023 | 0.5096 | 0.6023 | 4.26e-32 | |
4 | 6z1p:AR | 274 | 73 | 0.2386 | 0.0766 | 0.2877 | 0.33 | |
5 | 2qsc:H | 211 | 48 | 0.1705 | 0.0711 | 0.3125 | 0.89 | |
6 | 8htu:H | 95 | 18 | 0.0909 | 0.0842 | 0.4444 | 2.6 | 7ksq:H, 7kux:H, 6l35:H, 7xqp:H |
7 | 8opp:A | 670 | 34 | 0.1136 | 0.0149 | 0.2941 | 2.8 | |
8 | 8opt:A | 783 | 34 | 0.1136 | 0.0128 | 0.2941 | 3.0 | 8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B |
9 | 5vt3:B | 319 | 16 | 0.1136 | 0.0313 | 0.6250 | 4.5 | 5usx:A, 5usx:B, 5vt3:A |
10 | 8tr2:A | 745 | 21 | 0.1136 | 0.0134 | 0.4762 | 4.9 | 2e4u:A, 2e4u:B, 2e4v:A, 2e4v:B, 2e4w:A, 2e4w:B, 2e4x:A, 2e4x:B, 2e4y:A, 2e4y:B, 8tqb:A, 8tqb:B, 8tr0:B, 8tr2:B, 8trc:A, 8trc:B, 8trd:A, 8trd:B, 7wi6:A, 7wi6:B, 7wi8:A, 7wi8:B |
11 | 5u63:B | 319 | 15 | 0.1136 | 0.0313 | 0.6667 | 5.5 | 5u63:A |
12 | 8jcu:3 | 765 | 20 | 0.1136 | 0.0131 | 0.5000 | 6.0 | 6b7h:A, 5cnk:A, 5cnm:A, 8jcv:3, 8jcw:3, 8jcx:3, 8jcy:3, 8jcz:3, 8jd0:3, 8jd1:3, 8jd2:3, 8jd3:3, 3sm9:A, 8tr0:A, 7wih:A, 7wih:B, 4xar:A |
13 | 8jjm:A | 484 | 43 | 0.1591 | 0.0289 | 0.3256 | 6.4 | 8jjm:B |
14 | 4pu5:A | 438 | 20 | 0.1023 | 0.0205 | 0.4500 | 6.9 | |
15 | 6wb7:A | 296 | 52 | 0.1705 | 0.0507 | 0.2885 | 7.6 | 6wb7:B, 6wb7:C, 6wb7:D |
16 | 5k97:A | 341 | 27 | 0.1136 | 0.0293 | 0.3704 | 8.7 | 5kse:A, 3q8k:A, 3q8l:A, 3q8m:B, 3q8m:A, 5um9:A |
17 | 5zog:A | 316 | 27 | 0.1136 | 0.0316 | 0.3704 | 9.0 | 1ul1:X, 5zoe:A, 5zof:A |
18 | 5bwm:B | 205 | 41 | 0.1250 | 0.0537 | 0.2683 | 9.3 | 4xsh:B |
19 | 1ygp:A | 858 | 18 | 0.0909 | 0.0093 | 0.4444 | 9.3 | 1ygp:B |
20 | 5fv7:A | 283 | 27 | 0.1136 | 0.0353 | 0.3704 | 9.4 | 5fv7:B |