NNGSYPCPCCGNKTIDEPGCYEICPICGWEDDPVQSADPDFSGGANSPSLNEAKRAFNEQ
The query sequence (length=60) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ey3:A | 60 | 60 | 1.0000 | 1.0000 | 1.0000 | 1.29e-39 | 8ey4:I |
2 | 2hr5:A | 170 | 24 | 0.2000 | 0.0706 | 0.5000 | 0.24 | 2hr5:B, 3mps:A, 3mps:B, 3mps:D, 3mps:I, 3mps:F, 3mps:K, 3mps:G, 3mps:H, 1nnq:A, 1nnq:B, 3pwf:A, 3pwf:B, 3pza:A, 3pza:B, 3qvd:A, 3qvd:B, 3qvd:C, 3qvd:D, 3qvd:E, 3qvd:F, 3qvd:G, 3qvd:H |
3 | 6wq6:A | 547 | 53 | 0.2500 | 0.0274 | 0.2830 | 1.2 | 6wqi:A, 6wqi:B, 6wqs:A, 6wqt:A |
4 | 9c9y:A | 612 | 39 | 0.2000 | 0.0196 | 0.3077 | 2.6 | 9ca0:A, 9ca1:A |
5 | 3f2b:A | 994 | 53 | 0.2667 | 0.0161 | 0.3019 | 3.1 | 3f2c:A, 3f2d:A |
6 | 6scx:A | 328 | 27 | 0.2167 | 0.0396 | 0.4815 | 4.6 | 6o3p:A, 6scx:B, 6scx:C |
7 | 2ze0:A | 531 | 33 | 0.2000 | 0.0226 | 0.3636 | 7.7 | |
8 | 2akl:A | 116 | 32 | 0.2000 | 0.1034 | 0.3750 | 8.0 |