Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
NNCFRRVYHSNWEYLLSLEKEADAEPKQKALRYKQEKKQQFREKGLKLAAAKTA

The query sequence (length=54) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6zj3:L7 54 54 1.0000 1.0000 1.0000 2.63e-34
2 4mzv:A 243 41 0.2407 0.0535 0.3171 1.2
3 8sun:B 743 46 0.2593 0.0188 0.3043 1.6 8b8k:A, 8b8k:B, 8b8m:A, 6qp6:A, 6qp6:B, 8sur:B, 8tag:B, 8tai:B, 8tal:B
4 7tu2:A 434 27 0.2222 0.0276 0.4444 1.7 7tu0:A, 7tu0:B, 7tu0:C, 7tu2:B, 7tu2:C, 7tu3:A, 7tu3:B, 7tu3:C, 7tu4:A, 7tu4:B, 7tu4:C, 7tu5:A, 7tu5:B, 7tu5:C, 7tu5:D, 7tu5:E, 7tu5:F, 7tu6:A, 7tu6:B, 7tu6:C, 7tu6:D, 7tu6:E, 7tu6:F, 7tu7:A, 7tu7:B, 7tu7:C, 7tu7:D, 7tu7:E, 7tu7:F, 7tu8:A, 7tu8:B, 7tu8:C, 7tu8:D, 7tu8:E, 7tu8:F
5 5mr6:A 396 20 0.1481 0.0202 0.4000 2.8 5lvw:A, 5mr6:D, 5mr6:B, 5mr6:C, 5mr6:E, 5mr6:H, 5mr6:F, 5mr6:G, 5mr6:I, 5mr6:L, 5mr6:J, 5mr6:K, 5mr6:M, 5mr6:P, 5mr6:N, 5mr6:O, 5mr6:Q, 5mr6:R, 5mr6:S, 5mr6:T, 5mr6:U, 5mr6:V, 5mr6:W, 5mr6:X

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417