NLTLRYRSLVYQLNFDQTLRNVDKATWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAG
VNFCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVK
ILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTGMADKVDVKTWKSTEHNMGLALTRNAYQKLIEC
TDTFCTYDDYNWDWTLQYLTVSCLPKFWKVLVPQIPRIFHAMFPETLTISEKFTVVAISPPRKNGGWGDIRDHELCKSYR
RLQ
The query sequence (length=323) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5vcs:B | 323 | 323 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 5vcm:B | 358 | 352 | 0.9876 | 0.8911 | 0.9062 | 0.0 | 5vcm:A, 5vcs:A |
3 | 4rot:A | 268 | 161 | 0.1084 | 0.1306 | 0.2174 | 0.84 | |
4 | 1dbg:A | 481 | 94 | 0.0743 | 0.0499 | 0.2553 | 1.3 | 1dbo:A, 1ofl:A, 1ofm:A |
5 | 5x2m:D | 422 | 96 | 0.0774 | 0.0592 | 0.2604 | 2.4 | 5x2p:D |
6 | 2r8u:A | 131 | 33 | 0.0372 | 0.0916 | 0.3636 | 4.1 | |
7 | 5ggi:B | 551 | 58 | 0.0526 | 0.0309 | 0.2931 | 4.6 | 5ggi:A, 5ggj:A, 5ggj:B, 5ggk:A, 5ggk:B, 5ggl:A, 5ggl:B, 5ggn:A, 5ggn:B, 5ggo:A, 5ggo:B, 5ggp:A, 5ggp:B, 5xfc:A, 5xfc:B |
8 | 4rpm:A | 395 | 30 | 0.0402 | 0.0329 | 0.4333 | 6.4 | |
9 | 5jbd:B | 855 | 52 | 0.0588 | 0.0222 | 0.3654 | 8.9 | 5jbd:A, 5jbe:A, 5jbe:B, 5jbf:A, 5jbf:B |
10 | 5guw:B | 449 | 52 | 0.0433 | 0.0312 | 0.2692 | 9.7 | 5guw:D, 5gux:B, 3o0r:B, 3wfb:B, 3wfc:B, 3wfd:B, 3wfe:B |