NLSPLESLAWQVKCLLKYSTTWKPLNPNSWLYHAKLLDPSTPVHILREIGLRLSHCSHCVPKLEPIPEWPPLASCGVPPF
QKPLTSPSRLSRDHATLNGALQFATKQLSRTLSRATPIPEGCCCGWLTKTVKETTRTTYSYTDFQKAVNKLLTASL
The query sequence (length=156) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8g46:B | 158 | 159 | 0.9808 | 0.9684 | 0.9623 | 1.14e-105 | 8ov6:B |
2 | 7c2o:A | 365 | 74 | 0.1346 | 0.0575 | 0.2838 | 1.1 | 7c2o:B, 4oaq:A, 4oaq:B |
3 | 6x1o:C | 624 | 48 | 0.1218 | 0.0304 | 0.3958 | 6.7 | 6x1o:A, 6x6u:A, 6x6u:C |
4 | 8e29:A | 692 | 31 | 0.0705 | 0.0159 | 0.3548 | 7.8 | 8e28:A, 8e2a:A, 4pmw:A, 4pmw:B |
5 | 6cnb:R | 522 | 47 | 0.1090 | 0.0326 | 0.3617 | 9.5 | 8cen:O, 8ceo:O, 6cnc:R, 6cnd:R, 6cnf:R, 6eu0:Y, 6f40:U, 6f41:U, 6f42:U, 6f44:U, 8ffz:H, 5fmf:Q, 5fyw:O, 5fz5:O, 6gyk:O, 6gyl:O, 6gym:O, 7ml0:O, 7ml1:O, 7ml2:O, 7ml4:O, 1ngm:A, 1ngm:E, 1ngm:I, 1ngm:M, 1nh2:A, 7o4i:O, 7o4j:O, 7o72:O, 7o73:O, 7o75:O, 7oh9:K, 7oha:K, 7ohb:K, 5oqj:O, 5oqm:O, 7q5b:Y, 1rm1:A, 5sva:j, 4v1n:O, 4v1o:O, 1ytb:A, 1ytb:B, 1ytf:A, 7z7n:D, 7zb5:D, 7zb5:G, 7zs9:O, 7zsa:O, 7zsb:O |