BioLiP

>protein
NLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPEPATWSIG

The query sequence (length=57) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2heo:A	59	57	0.9123	0.8814	0.9123	8.72e-32	2heo:D, 1j75:A
2	3f21:A	67	59	0.3509	0.2985	0.3390	0.005	2acj:B, 2acj:C, 2acj:D, 3f21:B, 3f21:C, 3f22:A, 3f22:B, 3f22:C, 3f23:A, 3f23:B, 3f23:C, 2gxb:A, 2gxb:B, 3irq:B, 3irq:A, 3irq:D, 3irq:C, 3irr:C, 3irr:D, 3irr:A, 3irr:B, 1qbj:A, 1qbj:B, 1qbj:C, 5zu1:C, 5zu1:A, 5zu1:B, 5zuo:B, 5zuo:C, 5zuo:D, 5zup:B, 5zup:C, 5zup:D
3	4kmf:A	62	57	0.2807	0.2581	0.2807	0.008
4	2acj:A	53	59	0.3158	0.3396	0.3051	0.069	5zuo:A, 5zup:A
5	5zu1:D	47	59	0.3158	0.3830	0.3051	0.094
6	1sfu:A	70	25	0.2105	0.1714	0.4800	0.65	1sfu:B
7	5huq:A	433	22	0.1930	0.0254	0.5000	2.1	6c1w:A, 6c1w:B, 6c1w:C, 8ezf:B, 8ezh:B, 8ezi:B, 5huq:B
8	7t65:A	4252	30	0.2105	0.0028	0.4000	2.3	7t64:A, 7t64:B, 7t64:C, 7t64:D, 7t65:B, 7t65:C, 7t65:D
9	7tzc:A	4404	30	0.2105	0.0027	0.4000	2.3	3rqr:A, 8sen:A, 8sen:B, 8sen:C, 8sen:D, 8seo:A, 8seo:B, 8seo:C, 8seo:D, 8sep:A, 8sep:B, 8sep:C, 8sep:D, 8seq:A, 8seq:B, 8seq:C, 8seq:D, 8ser:A, 8ser:B, 8ser:C, 8ser:D, 8ses:A, 8ses:B, 8ses:C, 8ses:D, 8set:A, 8set:B, 8set:C, 8set:D, 7tzc:B, 7tzc:G, 7tzc:I
10	4hf1:A	129	40	0.2105	0.0930	0.3000	2.4	4chu:A, 4hf1:B, 4hf2:A, 4hf2:B
11	4chu:B	127	40	0.2105	0.0945	0.3000	2.9
12	6cig:A	349	35	0.1754	0.0287	0.2857	3.4	1fp2:A
13	2qyo:A	353	36	0.1579	0.0255	0.2500	5.4	2qyo:B
14	8bw6:A	99	26	0.1930	0.1111	0.4231	7.4
15	7cya:A	139	37	0.2105	0.0863	0.3243	7.4
16	7spq:A	316	20	0.1579	0.0285	0.4500	9.8

[Back]