NKINLNKPIIENKNNVDVSIKRYNNFVDIARLSIQKHFEHLSNDQKDSHVNNMEYMQKFVQGLQENRNISLSKYQENKAV
MDLKYHLQKVYANYLSQEE
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 2vwa:A | 99 | 99 | 1.0000 | 1.0000 | 1.0000 | 1.86e-67 | 2vwa:B, 2vwa:C, 2vwa:D, 2vwa:E, 2vwa:F |
| 2 | 6x3b:A | 300 | 39 | 0.1414 | 0.0467 | 0.3590 | 1.7 | 6x3b:B, 6x3b:C, 6x3b:D |
| 3 | 1rv8:B | 305 | 20 | 0.0808 | 0.0262 | 0.4000 | 9.4 | 1rv8:A, 1rv8:C, 1rv8:D, 1rvg:A, 1rvg:B, 1rvg:C, 1rvg:D |
zhanggroup.org