NHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEEVKLELAG
The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5gnj:B | 77 | 73 | 1.0000 | 0.9481 | 1.0000 | 1.81e-47 | 5gnj:G, 5gnj:I, 5gnj:A, 5gnj:E, 5gnj:F, 5gnj:M, 5gnj:N |
2 | 8ia3:E | 111 | 87 | 0.3973 | 0.2613 | 0.3333 | 3.40e-05 | 8ia3:A, 8ia3:B, 8ia3:F |
3 | 5i50:B | 96 | 73 | 0.3699 | 0.2812 | 0.3699 | 1.64e-04 | 5i50:A, 1nkp:A, 1nkp:D |
4 | 7xi3:A | 287 | 53 | 0.2603 | 0.0662 | 0.3585 | 0.001 | |
5 | 1an4:A | 65 | 52 | 0.2466 | 0.2769 | 0.3462 | 0.002 | 1an4:B |
6 | 1hlo:A | 80 | 51 | 0.2329 | 0.2125 | 0.3333 | 0.004 | |
7 | 5eyo:C | 88 | 51 | 0.2329 | 0.1932 | 0.3333 | 0.004 | 1an2:A, 5eyo:A, 1hlo:B, 1nkp:B, 1nkp:E, 1nlw:B, 1nlw:E |
8 | 8ow1:B | 116 | 47 | 0.2603 | 0.1638 | 0.4043 | 0.005 | 8ovw:A, 8ovw:B, 8ow0:A, 8ow0:B, 8ow1:A, 7ssa:L, 7ssa:K |
9 | 8osb:B | 66 | 43 | 0.2466 | 0.2727 | 0.4186 | 0.005 | |
10 | 5nj8:D | 134 | 51 | 0.2466 | 0.1343 | 0.3529 | 0.008 | |
11 | 7xi4:A | 283 | 51 | 0.2466 | 0.0636 | 0.3529 | 0.010 | 8g4a:A, 8g4a:B, 5nj8:B, 5sy7:A, 5v0l:A, 7xhv:A, 4zph:A, 4zpk:A |
12 | 4zpr:A | 235 | 54 | 0.2466 | 0.0766 | 0.3333 | 0.023 | |
13 | 4s2r:P | 615 | 52 | 0.2192 | 0.0260 | 0.3077 | 0.043 | 4s2r:Q, 4s2t:P, 4s2t:Q |
14 | 8osl:N | 290 | 57 | 0.2329 | 0.0586 | 0.2982 | 0.15 | 4h10:A, 8osk:N, 8osl:P |
15 | 7d8t:A | 199 | 51 | 0.2192 | 0.0804 | 0.3137 | 0.34 | 4ati:A, 4ati:B, 4atk:A, 4atk:B, 7d8t:B, 6g1l:A, 8vu0:A, 8vu0:B |
16 | 7xq5:A | 75 | 46 | 0.2329 | 0.2267 | 0.3696 | 0.45 | |
17 | 7tby:A | 1788 | 44 | 0.2329 | 0.0095 | 0.3864 | 0.66 | 7tc0:A |
18 | 7roq:A | 1831 | 44 | 0.2329 | 0.0093 | 0.3864 | 0.66 | |
19 | 7tbw:A | 1928 | 44 | 0.2329 | 0.0088 | 0.3864 | 0.66 | |
20 | 7m1q:A | 1911 | 30 | 0.1507 | 0.0058 | 0.3667 | 1.6 | |
21 | 8f5b:A | 1924 | 30 | 0.1507 | 0.0057 | 0.3667 | 1.6 | 7lkz:A |
22 | 7e7q:A | 1958 | 30 | 0.1507 | 0.0056 | 0.3667 | 1.6 | |
23 | 7e7o:A | 2003 | 30 | 0.1507 | 0.0055 | 0.3667 | 1.6 | 7lkp:A |
24 | 7w02:A | 1566 | 29 | 0.1918 | 0.0089 | 0.4828 | 3.6 | |
25 | 4eot:A | 92 | 19 | 0.1370 | 0.1087 | 0.5263 | 5.6 | 4eot:B |
26 | 2j28:9 | 430 | 26 | 0.1370 | 0.0233 | 0.3846 | 8.6 | 5aka:5 |
27 | 6uld:A | 428 | 25 | 0.1507 | 0.0257 | 0.4400 | 9.4 | 6uld:B |