BioLiP

>protein
NELRLEDNYVPTSDTLVVFKQLMKLPVTVLYDLTLSWFAKFGGSFDGDIYLLTETLDLLIEKGVRRNVIVNRILYVYWPD
GLNVFQLAEIDCHLMISKPEKFKWLPSKALRGDGKPYVVKLQPAKFIENLQTDLAKIYHCHVYMFKHPSLPVLITRIQLF
DSNKPLISRRPYYVAFPLNSPIIFHSVDKDIYARLVLQSISRTISERETIIFKPVQKIPVKSIHNIMTLLGPSRFAESMG
PWECYASANFERSPLHDYKKHQGLTGKKVMVREFDDSFLNDGKEEPEIRRLRLEKNMIKFKGSANGVMSRYSSLVPIEKV
GFTLKNEINSRIITIKLKFNGNDIFGGLHELCDKNLINIDKVPGWLAGENGSFSGTIMNGDFQREQ

The query sequence (length=386) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ovw:N	391	391	0.9974	0.9847	0.9847	0.0	8ow1:N
2	6agz:A	386	136	0.0855	0.0855	0.2426	0.50	6agz:B
3	2qm3:A	338	118	0.0881	0.1006	0.2881	0.84
4	6oix:C	478	82	0.0596	0.0481	0.2805	1.1	6oix:A, 6oix:B, 6oix:D, 6oix:E, 6oix:F, 7u66:A, 7u66:B, 7u66:C, 7u66:D, 7u66:E, 7u66:F, 7u67:A, 7u67:D, 7u67:C, 7u67:B, 7u67:F, 7u67:E
5	1pjc:A	361	54	0.0466	0.0499	0.3333	1.8	1say:A
6	6oiw:A	504	82	0.0570	0.0437	0.2683	2.2	6oi7:A, 6oi7:B, 6oi7:C, 6oi7:D, 6oi7:E, 6oi7:F, 6oiv:A, 6oiv:B, 6oiv:C, 6oiv:D, 6oiv:E, 6oiv:F, 6oiw:B, 6oiw:C, 6oiw:D, 6oiw:E, 6oiw:F, 6oiy:A, 6oiy:B, 6oiy:C, 6oiy:D, 6oiy:E, 6oiy:F, 4x9e:A, 4x9e:B
7	6dzg:A	288	45	0.0415	0.0556	0.3556	8.3	6dzg:B, 6dzg:C, 6dzg:D
8	5g0i:A	722	177	0.1218	0.0651	0.2655	8.5	5g0i:B

[Back]