NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERSGKVGGRDITNNQLDEALEETFPASDPIS
P
The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6grv:A | 81 | 81 | 1.0000 | 1.0000 | 1.0000 | 9.96e-56 | 6gv6:A, 6gv7:A, 6gw8:A |
2 | 1jjd:A | 52 | 49 | 0.2346 | 0.3654 | 0.3878 | 6.30e-06 | |
3 | 4y7s:A | 111 | 54 | 0.2099 | 0.1532 | 0.3148 | 3.0 | 4y7s:B, 4y7s:C |
4 | 6q89:A | 852 | 14 | 0.0988 | 0.0094 | 0.5714 | 5.6 | 7ntz:A, 7nu3:A, 7nu6:A, 7nu7:A, 7nub:A, 6q8b:A, 6q8c:A |
5 | 7nu2:A | 875 | 14 | 0.0988 | 0.0091 | 0.5714 | 5.7 | 7a0p:A, 7ap2:A, 7nty:A, 7nu0:A, 7nu1:A, 7nu4:A, 7nu5:A, 7nu8:A, 7nu9:A, 7nua:A, 7nuc:A, 6q8a:A, 6ykk:A, 6ykl:A, 6ykn:A, 6yko:A, 6ykq:A, 6yks:A, 6ykt:A, 6yku:A, 6ykv:A, 6ykw:A, 6ykx:A, 7yp8:A |
6 | 2z77:D | 130 | 64 | 0.2346 | 0.1462 | 0.2969 | 7.8 |