BioLiP

>protein
NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYW
FCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGM
YLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVT
FGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP

The query sequence (length=311) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4e4z:A	312	311	1.0000	0.9968	1.0000	0.0	6ala:A, 6ala:C, 6alv:A, 6amp:A, 6an3:A, 6ao6:A, 6ay0:A, 8dsj:A, 8dsj:K, 8dsl:A, 8dsl:B, 8dsn:A, 8dsn:K, 3mib:A, 3mic:A, 3mid:A, 3mie:A, 3mif:A, 3mig:A, 3mih:A, 3mlj:A, 3mlk:A, 3mll:A, 6nck:A, 1opm:A, 1phm:A, 3phm:A, 1sdw:A, 5wja:A, 5wja:D, 1yi9:A, 1yip:A, 1yjk:A
2	4zel:A	550	304	0.2830	0.1600	0.2895	1.66e-23
3	6cw3:E	120	56	0.0579	0.1500	0.3214	0.58	6cw2:C
4	6u3t:B	253	30	0.0386	0.0474	0.4000	1.9	6u3t:A
5	3m4e:C	293	38	0.0450	0.0478	0.3684	2.4	3m4e:B, 3m4e:G, 3m4e:F, 3m4e:E, 6u49:A, 6u49:C, 6u49:B, 6u49:G, 6u49:D, 6u49:E, 6u49:F, 6u4p:A, 6u4p:B, 6u4p:C, 6u4p:D, 6u4p:E, 6u4p:F, 6u4p:G
6	6lyc:A	110	26	0.0289	0.0818	0.3462	6.1
7	1h6f:B	186	42	0.0354	0.0591	0.2619	9.8	1h6f:A

[Back]