NDKEYDKHKRNQQARAFYHSREWERTRLAVLAKDNYLCQHCLKEKKITRAVIVDHITPLLVDWSKRLDMDNLQSLCQACH
NRKTAEDKRRYG
The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5h0m:A | 92 | 92 | 1.0000 | 1.0000 | 1.0000 | 2.08e-65 | 5h0o:A |
2 | 5mkw:A | 119 | 33 | 0.1630 | 0.1261 | 0.4545 | 0.002 | 5mkw:B |
3 | 8jal:B | 573 | 40 | 0.1739 | 0.0279 | 0.4000 | 1.1 | 8jal:A, 8jaq:A, 8jaq:B, 8jaq:J, 8jaq:K, 8jar:A, 8jar:B, 8jas:A, 8jas:B, 8jas:K, 8jas:J, 8jau:A, 8jau:B, 8jav:A, 8jav:B, 8jav:J, 8jav:K |
4 | 3oa8:B | 180 | 37 | 0.1304 | 0.0667 | 0.3243 | 2.2 | 3oa8:D, 3oa8:F, 3ocd:B, 3ocd:D |
5 | 8yb6:A | 350 | 75 | 0.2283 | 0.0600 | 0.2800 | 3.4 | 8yha:A |
6 | 7r2g:B | 351 | 54 | 0.1630 | 0.0427 | 0.2778 | 4.2 | 6cpm:C, 6cpm:D, 6crn:A, 6crn:B, 6crn:C, 6crn:D, 6gh9:A, 6gha:A, 6ml1:A, 6ml1:B, 7r2g:A |
7 | 8cli:B | 689 | 57 | 0.2065 | 0.0276 | 0.3333 | 5.2 | 8clj:B, 8clj:G, 8cll:B, 8cll:G |
8 | 7vws:B | 328 | 46 | 0.1739 | 0.0488 | 0.3478 | 7.2 | 7vws:A |
9 | 6cxt:B | 372 | 99 | 0.2500 | 0.0618 | 0.2323 | 9.9 | 6cy8:B |